SecReT6
Protein ID: 387901154
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0394
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]422467..422952 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDI2DJD6
KEGG IDbuk:MYA_0394
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|387901154|ref|YP_006331493.1| type VI secretion system lysozyme-related protein [Burkholderia sp. KJ006]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTELELAALPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVNFD
AMLQPSTLQYSVTRARAARMQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387900762|ref|NC_017920.1|:422467-422952 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAAACGCTTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAACTCGAGCTGGCGGCGCTGCCGGAATGCCAGAAATCGGTGCTCACCTACGGG
CTGAACGACTTCGCGGGCCTGAGCCTCGCGAGTCACTATGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATCGCACGCCACGAGCCGCGGTTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTGTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAGGAGCCGGTGAATTTCGAC
GCGATGCTGCAGCCGTCGACGCTGCAGTATTCGGTCACGCGCGCACGCGCGGCCAGAATGCAGTAA