SecReT6
Protein ID: 387901155
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0395
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]423030..424865 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDI2DJD7
KEGG IDbuk:MYA_0395
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.20E-216, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|387901155|ref|YP_006331494.1| type VI secretion protein, VC_A0110 family [Burkholderia sp. KJ006]
MEELLPYYERELSFLRRYSQDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIQRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARFTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPSLRAHLHGEQSFVAALTDCLFVNVLAA
YVEPERNGRWTALRNLPIAQAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDVAAIARAAGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQEGGAQTSGISMLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|387900762|ref|NC_017920.1|:423030-424865 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCAAGATTTCGCGG
AACGCTATCCGAAGATCGCGGCGCGGCTCGCGTTGTCGGGCGAGCATTGCGAGGATCCCCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCCGAGTTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAGT
TCACGCCGGCCTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCCAGCGCGGCACCGAGCTGAAGAGCCG
CCCGATTCGCGGCGTGCAATGCCGGTTCCGCACCGCCTACGACGTGACGCTCGCGCCGATCCGCATCTCC
GAGGCACGCTTCACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGACCTCGGCGCGCTGAAGCTGCCGTCGCTGCGCGC
GCACTTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTGGCCGCG
TACGTCGAGCCGGAGCGCAATGGCCGCTGGACCGCGTTGCGCAACCTGCCGATCGCGCAGGCCGGCTTCG
ACGAAGACGACGCGCTGATCGATTACCCGGCGAAGTCGCATCCCGCCTATCGGCTGCTGACCGAATACTT
CGCGTTTCCCGACAAGTTCGACTTCGTCGATTTCGACGTCGCGGCGATCGCGCGCGCGGCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTCGTGCTGCAGGACGTGCGCAGCGATTCGCATGTCGCGCGCCTGCTCGAGC
TGCTGACGGCCAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATCGCCGAGGCGCGGCGCGCGTTCGCGTACGAG
GTGTACTCGATCGATTCGGTGAAGCTCGTCAGGCAGCAGGCGCATGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTACTCGCTGCATCACGGCGAATCGGCGCGGATCGGCCACTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAAAAGAGCCCGGGCTACGAAACGGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAAACCGACACGCTGAGCCTCGACCTCACCTGCACCAACCGCGACCTGCCGGCGATGCTCGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGTGGCGCGCAGACGAGCGGCATCTCGATGCTGCGGCGCCC
GACGCAGAGCGTGCGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCATCTCGCGCTGAAC
CACGTGTCGCTGGTCGCGCACGGGCTCGCGCCGCTCAAGGAAATGCTGACCTTGTACGACCTGCGGCGCA
CCGCGGTGTCGATGCGCCAGATCGACGGCCTCGCCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCCACCTTCGTGCGCGGCATCGAGATTCGCCTGACCATCGACGAGGAGCATTTCGTC
GGCGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTGCACCTCAACAGTT
TCGTTCAACTAGTCGTGGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCTCGAACCGGCGA
ATCGATCCTGGCGTAG