SecReT6
Protein ID: 387901156
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0396
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]424829..425929 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDI2DJD8
KEGG IDbuk:MYA_0396
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.50E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|387901156|ref|YP_006331495.1| type VI secretion protein, VC_A0111 family [Burkholderia sp. KJ006]
MQASNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQRIEFRNTLSIGFPPS
EIEGARSFDDDGTPLDSGDARGAALAAGELGRVQLTPAFFGLLGGQGALPLHYTEQIVAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGPHAIALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
AAEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|387900762|ref|NC_017920.1|:424829-425929 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGCAAGCCTCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AGTTCTTCCAGGCCGTGCGCGTGCTCGAGGGGCTGTTCGCGCGGCAGGCGTCCGATGCGCCGGGCGCGTG
GCGGCAGGGCGACGTCGTCGCGCAGCGCATCGAGTTCCGCAACACGCTGTCGATCGGCTTCCCGCCGAGC
GAAATCGAAGGCGCGCGCTCGTTCGACGACGACGGCACGCCGCTCGATTCGGGCGACGCGCGCGGCGCGG
CGCTCGCCGCCGGCGAGCTCGGCCGCGTCCAGCTGACGCCCGCGTTCTTCGGGCTGCTCGGCGGGCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCATCTCAAGCGCGACCATGCGGCGCGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCCGCGTGGAAGAAGTACCGGCTGC
CGTTCCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTGTTGCTCGCGATCGCCGGCGTGCCGAG
CGACGAGGTGCGCGACAGTCTCGCGGCCGGCGCGGGCGGCGTGCTCGACGAAGCCGTCGCCGGCTACGCG
CTGGCCGCGCGGCATCGGCCGATGTCGGCCGCGTACCTGCAGCGCACGCTGTCCGACTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGCGA
AGTCAACGCCGTGCTCGGCGCGACGGCGCTGGTCGGCGAACGGGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGATTACGAAGCGTTCCTGCCGGGCGGCCCGCACGCGATCGCGC
TCGAACGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAGGTCAAGCTCGTGCTCAAGCGCAC
GGAAGTGGGCGCGAGCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCGGCGGAGGATCGCTCCGACGCCCGCTACGAGCTGCACGTGATTCACTGA