SecReT6
Protein ID: 387901158
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0398
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]428680..429801 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDI2DJE0
KEGG IDbuk:MYA_0398
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|387901158|ref|YP_006331497.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. KJ006]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRHDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDYWDTVHPLPEGDDVEYRLGNVAWLSGRTAELLRG
VAVTDGASNAFTTLDWEVAQHVAQAVKRDPEHAEEIARGKPSVEQIDASRRVTPIAFYTALLANLKAFEF
ALDAFEERLVERAGDSAPSFRQTRDAFETVYRLVERFAREQGYTGSAPHAPSAQQAQPERVEPSFGDAFH
TEETHVQTQTASRAPVAQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|387900762|ref|NC_017920.1|:428680-429801 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGATGCGCGGCGCCATGACGATCCGACGCTCGACCAGGGCGAATG
GGTGACCGAAATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCCGGCGAGCTGCTGCGCACGCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGCCTCA
CCGAAGGTTATGCGCTGCTGGAAGGCCTGTGCCGCGACTACTGGGACACCGTGCATCCGCTGCCCGAAGG
CGACGACGTCGAATACCGGCTCGGCAACGTCGCGTGGCTGTCGGGGCGCACGGCCGAGCTGCTGCGCGGC
GTCGCGGTGACCGACGGCGCGTCGAACGCGTTCACCACGCTCGACTGGGAGGTCGCGCAGCATGTGGCGC
AGGCCGTGAAGCGCGATCCCGAACACGCCGAGGAAATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGA
TGCATCGCGGCGCGTGACGCCGATCGCGTTCTACACGGCGCTGCTCGCGAACCTGAAGGCGTTCGAGTTC
GCGCTCGACGCGTTCGAGGAGCGGCTGGTCGAACGCGCGGGCGATTCGGCGCCGAGCTTTCGGCAGACGC
GCGATGCGTTCGAGACCGTGTATCGGCTCGTCGAGCGTTTCGCGCGCGAGCAGGGATATACGGGCAGCGC
ACCGCACGCGCCGTCGGCGCAGCAAGCGCAGCCGGAGCGCGTCGAACCGAGCTTCGGCGACGCGTTCCAC
ACCGAGGAGACCCATGTGCAGACGCAGACCGCTTCGCGTGCGCCGGTGGCGCAAATGATCGCCGGCATCC
AGAACCGCGCGCAGGCCGTCGACCAGCTGCGCGCGGTCGCGCGTTACTTCCGCCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCGGACAAGGCCGCGGAATGGGCCGACATGCCGCTGCACAAGTGGCTGGAGAGC
GTCGTGAAGGACGACGGATCGCTGTCGCATATCCGCGAGCTGCTCGGCGTGAGGCCCGACGAGCAGTCGT
GA