SecReT6
Protein ID: 389841184
SecReT6 ID662
T6SS typei2
Gene symbol-
Locus tagES15_2184
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2323831..2326245 [-]
Producthypothetical protein
NoteTssI
UniProt IDI2EJA5
KEGG IDcsk:ES15_2184
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.50E-56, Aligned region: 17..324
DUF2345 [PF10106], Evalue: 1.30E-32, Aligned region: 587..711
T6SS_Vgr [PF13296], Evalue: 1.20E-29, Aligned region: 455..560
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 355..449
Protein Sequence: 804 a.a.     [Download]
>gi|389841184|ref|YP_006343268.1| hypothetical protein ES15_2184 [Cronobacter sakazakii ES15]
MIHNSDITPDVLRFRGREALSEPFFWNIEFTTPQAGLLPEQMLMKYASLRMRGGRTIYGILTRLEWLSTT
ADQSHYSVTLSSRLALLSHTRQCRVFLNQSVPEVVEQVLREHGLEGADFDFRLEREYPERELITQWRETD
LEFIQRLLSEVGIWWRTEMDSLRGLDVTIFADSQLNYHFDVRLPYREASGLHDGAQEAVWGVRTWHNAVT
GRVQTRDYYYPAATTPLGTTVRVRSTAVTTGEHYRYAEPYREQGDDTDPEPDSESGAFYARIHHERELNN
SLRVHLFSNADALTPGMVLEPQGDVIRALKEGVIITLTTFRASRDSRLHVSVWGMPYSERYCYRLPECPR
PEVHGTVPARVESRDPKDTYAWLDDAGRYRVKLDMDREGSDSGYSYLWVRQAKPYAGETYGWHTPLLTGT
EVAVAFDGGDPDRPYIAHAFHDSAHPDVVSRDNRSRNILRTPAQNELRIEDKRGEEHIHLTTEYGKTQLG
EGRLVDGQDKPRGAGFELRTDEYGVIRVAKGLFISADGQQKAAGEVLDRETALKEIDLCLQQIAQLSASA
DAANALQADIASQSAMFSERLKPLNELIHMQAPDGMAFTSGEHTQLTATKNVAVSAGGDISVGVMGNMTA
LAGEKLGLFARSGPLSLKSGEGPLEVQAQNGGMQLAAEKKVTLTSVSDISFAGKKRITLIGGGSYLKLEA
GKIEYGTPQVYLRKVEKTYLGASKSRQAEFPYLPGKEGVYSRGFILLDDRTNEPAAGIAYRLTLSSGEKV
ENVSNNKGCTYIMSHKEKHEVELTILRQESLIIG
 
Nucleotide Sequence: 2415 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2326245-2323831 Cronobacter sakazakii ES15 chromosome, complete genome
GTGATCCACAACAGTGATATCACACCGGACGTGCTGCGTTTTCGTGGGCGCGAGGCCTTAAGCGAACCGT
TTTTCTGGAATATCGAGTTTACCACCCCGCAGGCAGGCCTCCTGCCCGAACAGATGCTGATGAAATACGC
AAGCCTCAGGATGCGGGGCGGCAGAACGATTTACGGCATCCTTACCCGGCTGGAGTGGCTCTCTACCACG
GCGGATCAGTCGCACTACAGCGTGACGCTCTCCTCCCGGCTGGCGCTGCTGTCTCACACGCGTCAGTGTC
GCGTATTTCTCAACCAGTCGGTACCCGAAGTGGTGGAGCAGGTACTGCGCGAGCATGGCCTGGAAGGGGC
GGATTTTGATTTCCGGCTGGAGCGGGAATACCCGGAGCGTGAGCTTATCACCCAGTGGCGCGAGACTGAC
CTTGAATTTATTCAGCGGCTGCTGTCAGAAGTGGGGATCTGGTGGCGCACGGAAATGGACAGCCTGCGCG
GTCTGGATGTGACGATTTTTGCTGACAGCCAGCTCAATTATCATTTTGACGTCCGCCTGCCGTATCGCGA
GGCGTCCGGCCTGCATGACGGCGCGCAGGAAGCGGTCTGGGGCGTGCGCACCTGGCATAACGCCGTCACT
GGCAGGGTGCAGACGCGCGACTATTATTACCCGGCCGCCACCACGCCGCTGGGCACCACTGTCAGGGTGC
GTAGCACGGCAGTGACCACCGGCGAACATTATCGTTACGCGGAGCCGTACCGGGAGCAGGGCGATGACAC
CGATCCAGAACCGGACAGCGAAAGCGGGGCGTTTTACGCCCGGATTCACCATGAGCGTGAGCTCAATAAC
TCGCTGCGGGTGCATCTCTTCAGCAACGCCGACGCGCTCACGCCGGGGATGGTGCTGGAGCCGCAGGGCG
ACGTCATCCGCGCGCTGAAAGAAGGGGTGATTATCACGCTCACCACTTTTCGCGCCTCGCGCGATTCGCG
GCTGCATGTGTCGGTGTGGGGGATGCCCTACAGTGAACGCTACTGCTACCGCCTGCCAGAATGCCCGCGC
CCGGAAGTTCACGGCACGGTGCCGGCCCGGGTGGAAAGTCGTGACCCGAAAGACACGTATGCCTGGCTGG
ACGACGCAGGCCGCTACAGGGTGAAGCTGGACATGGACCGTGAGGGCAGCGACAGCGGCTACAGCTATCT
GTGGGTGCGCCAGGCGAAGCCGTATGCGGGCGAAACATACGGCTGGCACACGCCGCTACTGACGGGCACG
GAAGTGGCCGTCGCCTTTGACGGCGGCGACCCGGACCGGCCCTATATCGCGCACGCCTTTCATGATTCGG
CGCACCCGGATGTCGTCAGCCGTGATAACCGCAGCCGGAATATCCTGCGCACGCCTGCACAGAACGAACT
GCGCATTGAAGATAAACGGGGCGAAGAGCACATCCATCTGACCACCGAATACGGCAAAACGCAGCTCGGC
GAAGGGCGGCTGGTGGACGGGCAGGATAAACCGCGCGGTGCGGGCTTTGAGCTGCGCACCGATGAATATG
GTGTCATTCGCGTGGCGAAGGGGTTGTTCATCAGCGCCGACGGGCAGCAGAAGGCGGCGGGCGAGGTGCT
GGACCGGGAAACGGCGCTGAAGGAAATCGACCTGTGCCTGCAGCAGATAGCGCAGCTCTCCGCTTCAGCA
GACGCGGCGAACGCGCTGCAGGCAGACATCGCCAGCCAGAGCGCGATGTTCAGCGAGCGGCTGAAACCGC
TGAACGAACTGATTCACATGCAGGCCCCGGACGGTATGGCATTCACCAGCGGCGAGCACACGCAGCTTAC
GGCCACGAAGAATGTGGCGGTGAGTGCGGGTGGCGATATCAGCGTGGGCGTTATGGGCAACATGACTGCA
CTGGCGGGTGAAAAACTGGGGCTGTTCGCCCGCAGCGGGCCGCTGAGCCTGAAATCAGGCGAGGGCCCGC
TGGAGGTGCAGGCACAGAACGGCGGCATGCAGCTCGCGGCAGAGAAGAAAGTCACCCTCACATCGGTGAG
CGATATTTCCTTTGCAGGCAAAAAGCGCATCACCTTAATCGGCGGCGGAAGTTATCTGAAGCTGGAAGCC
GGGAAAATAGAGTACGGCACACCTCAGGTATATCTGAGGAAGGTGGAAAAAACTTATCTGGGAGCGAGTA
AATCCCGGCAGGCTGAATTCCCATATTTGCCCGGCAAGGAGGGTGTTTATAGCAGAGGTTTTATTCTGCT
TGATGACAGAACAAATGAGCCGGCCGCAGGAATAGCATATAGACTGACATTATCATCAGGAGAGAAAGTG
GAAAATGTTTCTAATAATAAAGGGTGTACTTATATTATGAGCCATAAAGAAAAACATGAAGTTGAGTTAA
CTATTCTCAGACAAGAATCATTGATAATAGGTTAA