SecReT6
Protein ID: 389841185
SecReT6 ID662
T6SS typei2
Gene symbolvasD1
Locus tagES15_2185
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2326303..2326824 [-]
Producttype VI secretion system core protein VasD
NoteTssJ
UniProt IDI2EJA6
KEGG IDcsk:ES15_2185
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-38, Aligned region: 14..163
Protein Sequence: 173 a.a.     [Download]
>gi|389841185|ref|YP_006343269.1| type VI secretion system core protein VasD [Cronobacter sakazakii ES15]
MPNKGWHAITLALCCVMTGCGLTQAVKDGTVSMAKSVFYKKIKTLHLDFSARAALNVDGDQTPLATMVRV
YQLKDHKTLDAADYGSLLQNADTVLKDDLLASRELLIIPKGNVTLDMPMEENAQFVAVVGLFNHPDVKDN
RWRLVLSREDLDPDKPGVVELGDGWLNLVETKE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2326824-2326303 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCCAAACAAAGGATGGCATGCGATAACGCTCGCGCTGTGCTGCGTCATGACGGGTTGTGGTCTTACCC
AGGCGGTGAAAGACGGGACGGTCAGTATGGCGAAATCGGTGTTTTATAAAAAGATCAAAACACTACATCT
CGATTTTTCTGCCCGAGCGGCGCTTAACGTGGATGGTGACCAGACGCCGCTTGCGACCATGGTCAGGGTC
TATCAGCTAAAAGATCATAAAACTCTCGATGCGGCTGATTACGGCTCGTTATTGCAGAATGCGGACACCG
TACTGAAAGATGATCTGCTGGCTTCCCGCGAGTTGCTCATCATCCCGAAGGGTAATGTCACGCTTGATAT
GCCGATGGAAGAAAACGCACAGTTTGTAGCGGTAGTGGGGCTGTTTAACCATCCTGACGTCAAAGACAAC
CGCTGGCGACTGGTGCTTTCCCGGGAGGATCTTGACCCGGATAAACCAGGAGTGGTGGAGCTGGGTGACG
GCTGGCTCAATCTGGTGGAGACAAAGGAATGA