SecReT6
Protein ID: 389841186
SecReT6 ID662
T6SS typei2
Gene symbolvasB
Locus tagES15_2186
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2326850..2327932 [-]
Producttype VI secretion system core protein VasB
NoteTssG
UniProt IDI2EJA7
KEGG IDcsk:ES15_2186
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-85, Aligned region: 18..321
Protein Sequence: 360 a.a.     [Download]
>gi|389841186|ref|YP_006343270.1| type VI secretion system core protein VasB [Cronobacter sakazakii ES15]
MAREPQPAHTGLTQQLGEEIWRVNFYRFCQLLEQEHPDHPLLGSTSYPENDPVRFRSWPGMGFPASELRR
VETDDEHPGSPPAVRTTFLGMYGVDSPLPGNYLDDIAQRREGQEAVSSFLDIFGHRIATQYYRIWRKYAY
PATFEPGGTDATSQCLLGLVGLGIPGTAEHIATPVSRFLALLGAMRLPTRNAEGIRALVTLLAPDTRAEI
HERDPVKVRVTNRSGLGGGERVRLAQRATLGKMARDANSRVLITLFTRNPQEAAGWLPGGQLHTDLLALM
RVYLGYRSDARLRLTVPVHLLPEPKLAKHRRIQLGRTGLLGLKGGKLSDNRQCITVSLGCYESLSCTVLP
LAAEGSYRFD
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2327932-2326850 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGCGCGAGAACCACAGCCAGCACATACCGGGCTGACGCAGCAATTAGGCGAGGAGATCTGGCGCGTTA
ATTTCTATCGCTTCTGCCAGTTGCTTGAGCAGGAACATCCTGACCATCCGCTCCTGGGAAGCACCAGCTA
CCCTGAAAATGATCCGGTGCGGTTTCGCTCTTGGCCGGGCATGGGATTTCCGGCCAGTGAATTACGCCGC
GTGGAAACGGATGACGAACACCCCGGCTCCCCGCCCGCGGTACGCACTACGTTTCTCGGCATGTACGGCG
TCGACTCGCCGCTACCGGGCAACTATCTGGATGATATCGCCCAGCGGCGCGAAGGGCAGGAAGCCGTATC
CTCGTTTCTGGATATCTTCGGCCACCGTATCGCCACACAGTATTACCGCATCTGGCGGAAATATGCGTAC
CCGGCCACGTTTGAGCCCGGCGGGACAGATGCCACTTCTCAATGCCTGCTAGGGCTGGTCGGACTTGGCA
TTCCCGGCACGGCAGAACATATCGCTACCCCCGTTTCGCGTTTTCTCGCGCTGCTCGGCGCCATGCGCTT
ACCGACGCGAAATGCTGAGGGAATACGCGCGCTGGTGACTCTGCTGGCACCAGACACACGGGCAGAGATC
CATGAGCGCGATCCTGTAAAAGTGCGGGTGACAAACCGCAGCGGGCTGGGGGGAGGCGAACGAGTACGTT
TAGCGCAGCGTGCGACACTCGGAAAAATGGCGCGTGATGCAAACAGTCGGGTGCTCATTACATTATTCAC
CCGCAATCCGCAGGAGGCTGCAGGCTGGCTGCCGGGCGGGCAATTGCATACTGATTTGCTGGCGCTGATG
CGGGTTTATCTCGGCTATCGCAGTGACGCACGGCTTCGCCTGACAGTGCCGGTACATTTACTCCCTGAAC
CAAAGCTTGCGAAACATCGGCGCATTCAGCTTGGCCGCACAGGCCTGCTGGGTTTGAAAGGCGGCAAACT
CAGCGATAACCGCCAGTGCATCACGGTCAGCCTGGGATGTTATGAAAGCCTGAGTTGCACGGTATTGCCG
CTTGCCGCAGAGGGCAGTTACCGCTTCGACTAA