SecReT6
Protein ID: 389841187
SecReT6 ID662
T6SS typei2
Gene symbolvasA
Locus tagES15_2187
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2327896..2329665 [-]
Producttype VI secretion system core protein VasA
NoteTssF
UniProt IDI2EJA8
KEGG IDcsk:ES15_2187
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.20E-186, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|389841187|ref|YP_006343271.1| type VI secretion system core protein VasA [Cronobacter sakazakii ES15]
MDDLTLRYYEAEMRYLREAGKEFSRAHPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLSIVEFSPDWRGLRQLESLPEGFSVLSRPVGPRKTACQYRTTREITLQPVS
LTEARLHTEPDGRSAIRLRFACSQKVDWTKSGIDKVAIFLNAESPVSSALHLALTRRVHAMYARHSTTHA
ERLRFDGWFRPMGFDDTDRLWPKGDSAFSGYQLLLEYFSFRQKFMFVELRGLESIGLTAESDWFEIDIVL
TEGWPADLPFETENFRLHCAPVINLFTLEADPLTLNPLENEYLLRPLRLQDGHTEIYSVDDIHGAVKNGK
HPYVPFTSFRHRGGMMRFDAPERYFHTRVKRGPSGLHDTWLILGGRSFEIEQLAEKPESLSMRITGTNGQ
LPRKALQSTLIDRVVKIGKVPVSVINLTAPTMPLYPPASDRFHWRVMSHLGSNFLSMMDNPEVLRGTLAL
YDWTDDEMNRRRLDAIVAVKHTLIRRFEQGFMQRGVDIEVTLDTQHFAGEGDVNLFGEMLHRFFALYTDI
HLFNQLTLVLQPTGKRLRWRENHSQHIPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2329665-2327896 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGATGATTTAACACTGCGCTACTACGAGGCAGAAATGCGCTATCTGCGCGAAGCCGGAAAGGAGTTTT
CCCGCGCGCACCCTGACCGTGCAGCGATGCTCAATCTGGACAAGCCCGGCGCCCGCGATCCTTACGTCGA
ACGCCTGTTTGAAGGGTTTGCGTTTTTGATGGGGCGGCTTCGTGAAAAGCTTGATGACGATCTCCCCGAA
CTCACGGAAGGGCTGGTCAGCCTGTTGTGGCCGCACTATATGCGTACCATTCCGTCGCTGTCGATCGTGG
AGTTTTCGCCTGACTGGCGCGGGCTCAGGCAGTTGGAATCCTTACCGGAAGGCTTTTCCGTTTTATCTCG
TCCGGTCGGCCCCCGGAAAACGGCCTGCCAGTATCGCACTACCCGCGAGATAACGCTGCAACCGGTTAGT
CTCACTGAGGCTCGCTTGCACACTGAACCTGACGGGCGTTCTGCCATTCGTCTGCGTTTTGCATGCAGCC
AGAAAGTGGACTGGACGAAATCCGGCATCGATAAAGTCGCCATTTTTCTTAACGCGGAAAGCCCGGTGAG
TTCTGCGCTTCATCTGGCATTAACTCGCCGTGTGCATGCCATGTATGCGCGCCACAGCACAACCCATGCT
GAACGCCTGCGCTTTGACGGCTGGTTTCGCCCGATGGGTTTTGATGATACGGACCGGCTGTGGCCGAAAG
GCGACTCCGCGTTCAGTGGCTATCAGTTACTGCTGGAGTATTTCAGCTTCCGGCAGAAGTTTATGTTTGT
CGAGTTGCGTGGGCTGGAATCGATTGGACTCACTGCCGAAAGTGACTGGTTTGAAATCGATATTGTCCTC
ACAGAAGGATGGCCTGCCGATCTGCCGTTTGAAACCGAAAACTTTCGTCTGCACTGCGCGCCGGTAATTA
ACCTTTTCACGCTGGAAGCTGACCCGCTGACGCTCAATCCACTGGAAAACGAATACCTGTTGCGGCCGCT
GCGCCTTCAGGACGGCCATACGGAAATTTACAGCGTTGATGACATTCACGGCGCTGTGAAAAACGGTAAG
CATCCTTATGTGCCCTTTACCAGTTTTCGCCACCGGGGCGGCATGATGCGGTTCGATGCGCCAGAGCGCT
ACTTCCATACTCGTGTGAAGCGCGGCCCGTCTGGCCTGCACGATACCTGGCTGATTCTTGGTGGCCGCTC
GTTTGAAATCGAACAACTGGCGGAAAAACCGGAATCGCTCTCAATGCGTATCACCGGCACCAACGGCCAG
CTTCCCCGCAAAGCGTTGCAAAGCACGCTGATTGACCGGGTAGTGAAAATTGGCAAAGTGCCGGTCAGCG
TGATTAACCTCACGGCACCCACGATGCCGTTGTATCCCCCTGCGAGCGATCGTTTTCACTGGCGCGTGAT
GAGTCATCTGGGTTCGAACTTTCTCAGCATGATGGACAACCCCGAGGTGCTGCGCGGCACGCTGGCGCTC
TACGACTGGACCGACGATGAGATGAATCGTCGACGTCTTGACGCGATCGTCGCGGTGAAACACACCCTTA
TACGTCGCTTTGAACAGGGGTTTATGCAAAGAGGGGTGGATATCGAAGTGACTCTGGACACGCAGCATTT
TGCCGGTGAGGGCGATGTGAATCTGTTTGGTGAAATGCTGCATCGCTTCTTTGCACTTTACACGGATATT
CATCTTTTTAATCAGCTCACGCTGGTATTGCAACCGACAGGGAAGAGACTGAGATGGCGCGAGAACCACA
GCCAGCACATACCGGGCTGA