SecReT6
Protein ID: 389841190
SecReT6 ID662
T6SS typei2
Gene symbol-
Locus tagES15_2190
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2334956..2335240 [-]
Producthypothetical protein
NoteTssI
UniProt IDI2EJB1
KEGG IDcsk:ES15_2190
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 3.40E-06, Aligned region: 19..53
T6SS_Vgr [PF13296], Evalue: 0.00034, Aligned region: 58..85
Protein Sequence: 94 a.a.     [Download]
>gi|389841190|ref|YP_006343274.1| hypothetical protein ES15_2190 [Cronobacter sakazakii ES15]
MLALDGIPYSETVYFRPPLLDGTEVSVAFDSGDPDRPYIAHARHDSAHPDHVTRDNHTRNVLRTPANNKL
RMEDQRQQEHIKLAINYAWGAYSE
 
Nucleotide Sequence: 285 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2335240-2334956 Cronobacter sakazakii ES15 chromosome, complete genome
TTGCTGGCGTTGGACGGCATTCCCTACAGCGAAACGGTCTATTTTCGCCCGCCGCTGCTGGACGGCACGG
AAGTGTCGGTGGCGTTCGACAGTGGCGACCCGGACCGTCCGTACATCGCCCACGCGCGGCATGACTCGGC
ACACCCGGACCACGTGACGCGCGACAACCACACCCGCAACGTGCTGCGCACGCCCGCGAACAACAAATTA
CGGATGGAAGACCAGCGGCAACAGGAGCACATCAAGCTCGCCATAAATTACGCCTGGGGGGCATATAGTG
AATGA