SecReT6
Protein ID: 389841192
SecReT6 ID662
T6SS typei2
Gene symbol-
Locus tagES15_2192
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2336059..2338419 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI2EJB3
KEGG IDcsk:ES15_2192
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-65, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 1.40E-65, Aligned region: 488..528
DUF2345 [PF10106], Evalue: 6.30E-39, Aligned region: 610..756
T6SS_Vgr [PF13296], Evalue: 1.40E-35, Aligned region: 487..592
T6SS_Vgr [PF13296], Evalue: 1.40E-35, Aligned region: 636..654
Phage_base_V [PF04717], Evalue: 3.00E-15, Aligned region: 18..38
Phage_base_V [PF04717], Evalue: 3.00E-15, Aligned region: 401..482
Protein Sequence: 786 a.a.     [Download]
>gi|389841192|ref|YP_006343276.1| Rhs element Vgr protein [Cronobacter sakazakii ES15]
MMSDAIMEKNAQKAAQLLGQSRYRVDIHGCNDFLDVLSFSAEEALSKPWYYDIALTCDNPDIACDTLLLK
PGSFTFQTPLFTGAPATEVRSVYGVVQSFRRVSTSADETHYTLRLVPRIALMHHTRRNEIYLNQSVIEVV
ENVLREHELEGADFEFRLSREYPERELITQWRETDLEFVQRLLAEVGIFWRFEMDSRLGQDVVIFMDSPE
QYQFGVTLPLRHPSGMSDSGQESVWDLRTAYQVVSGSVATRDYNYREALTPQDSTQSVSSTDDITTGEVY
HYAEPFLTEGDPDSPETGAYYARLRHERLLNEQALMTGRSTSPHLLPGQVLEVEGSVPEALTAGIVITRV
RSRGSRRASFLLDFEGIPYSETVCFRPPLRRRPVISGTLPARVESTQKGDIYAWLDETGRYRVKLDVDRN
GREQGYAYLWLRLAKPYAGDNYGWHAPLLDGTEVSVAFDSGDPDRPYIAHAQHDSAHPDHVTRDNHTRNV
LRTPANNKLRMEDQRRQEHIKLATEYGKTQLNLGHLVDAQRQARGTGFELRTDEYGAVRAAKGIYLSAHE
QLKAQGPVLAMTETLSQINQANSEMQALNNAAKVAQALTCDIGTQLNLVQDRLAQLHSAVVLASAPSGVA
LSSGEHLQLTSTKNTMINAGQHLDVGAMKNLSVTVEKALGLFVHKDGAKVVANQGEVEIQAQHNTMSLFA
RDRFTITSNEDEIVISTPETLTLNGGGSYLKLSKSGIEHGSQGDMLMKVAMYLVTGTGATLPHEAPEFSM
KDITQENTMSSKAFND
 
Nucleotide Sequence: 2361 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2338419-2336059 Cronobacter sakazakii ES15 chromosome, complete genome
ATGATGAGTGACGCTATCATGGAAAAAAACGCCCAAAAGGCGGCGCAGCTTCTGGGCCAGTCGCGGTATC
GGGTCGATATTCATGGCTGTAATGATTTTCTTGATGTGCTGAGCTTCAGCGCAGAAGAGGCACTCAGCAA
GCCCTGGTACTACGATATTGCGCTTACGTGTGACAACCCGGATATCGCCTGCGACACGCTGCTGCTCAAA
CCCGGTTCATTTACCTTTCAGACACCCCTTTTTACCGGCGCGCCCGCGACAGAGGTGCGCAGTGTCTATG
GTGTCGTGCAGTCGTTCCGGCGTGTTTCGACTTCAGCAGACGAAACGCATTACACGCTGCGGCTGGTGCC
GCGAATCGCCCTGATGCACCACACCCGGCGCAATGAAATCTACCTTAATCAGTCGGTGATTGAGGTGGTG
GAAAACGTACTGCGCGAGCATGAGCTGGAAGGCGCTGATTTCGAATTTCGGCTGTCGCGCGAATACCCTG
AGCGTGAACTGATCACCCAGTGGCGCGAAACCGATCTGGAATTTGTTCAGCGCCTGTTAGCAGAAGTGGG
CATTTTCTGGCGTTTTGAAATGGACAGCCGTCTGGGTCAGGATGTCGTGATCTTTATGGATTCGCCAGAA
CAGTACCAGTTTGGCGTGACGCTGCCGCTGCGCCATCCGTCAGGCATGAGCGACAGCGGGCAGGAAAGCG
TCTGGGATCTGCGGACCGCGTATCAGGTGGTGAGCGGCAGCGTTGCCACCCGCGACTATAACTACCGCGA
GGCGCTGACGCCACAGGACAGCACGCAGTCTGTCAGCAGCACGGACGATATAACCACCGGTGAGGTGTAT
CACTATGCCGAACCTTTTCTGACCGAAGGCGACCCTGACAGCCCGGAGACCGGTGCGTATTACGCCAGGC
TTCGCCACGAGCGTCTCCTCAACGAACAGGCTCTGATGACCGGGCGCAGCACCAGCCCGCATCTGTTACC
CGGCCAGGTGCTGGAGGTGGAGGGCAGCGTGCCAGAGGCCCTGACCGCAGGCATTGTCATTACCCGTGTC
CGCAGCCGCGGTTCGCGCCGGGCCAGTTTTCTTCTGGATTTTGAGGGCATTCCCTACAGCGAAACGGTCT
GTTTTCGCCCGCCGCTGCGCAGGCGGCCGGTGATTTCGGGCACGCTGCCCGCCCGTGTCGAGAGCACGCA
GAAAGGAGATATCTACGCCTGGCTGGATGAGACCGGGCGTTACCGGGTGAAGCTGGATGTTGACCGTAAC
GGGCGCGAGCAGGGCTACGCGTACCTGTGGCTGCGGCTGGCAAAACCCTACGCGGGGGATAATTACGGCT
GGCACGCGCCGCTGCTGGACGGCACGGAGGTGTCGGTGGCGTTCGACAGCGGCGATCCGGACCGTCCGTA
CATCGCCCACGCGCAGCATGACTCCGCACACCCGGACCACGTGACGCGCGACAACCACACCCGCAACGTG
CTGCGCACGCCCGCGAACAACAAATTACGGATGGAAGACCAGCGGCGGCAGGAGCACATCAAGCTCGCCA
CGGAGTACGGCAAAACGCAGCTGAACCTGGGGCATCTGGTGGACGCGCAGCGGCAGGCGCGCGGCACGGG
TTTTGAACTGCGAACGGATGAGTACGGCGCGGTGCGTGCGGCGAAGGGGATATACCTGTCGGCGCATGAG
CAGCTGAAGGCGCAGGGCCCGGTGCTGGCGATGACAGAGACGCTGAGCCAGATAAACCAGGCGAACAGTG
AGATGCAGGCACTGAACAACGCGGCGAAGGTGGCACAGGCGCTGACCTGCGATATCGGCACGCAGCTGAA
CCTGGTGCAGGACCGGCTGGCGCAGCTGCACTCGGCGGTGGTGCTGGCAAGTGCGCCGAGTGGCGTGGCG
CTCAGCTCCGGGGAGCACCTGCAGCTGACCAGCACAAAAAACACGATGATAAACGCCGGTCAGCATCTGG
ACGTGGGGGCGATGAAGAACCTGTCGGTGACGGTGGAAAAGGCGCTGGGGCTGTTTGTGCACAAAGATGG
CGCGAAGGTGGTGGCGAACCAGGGTGAGGTGGAGATACAGGCGCAGCACAACACGATGTCGCTGTTTGCG
CGTGACCGTTTCACCATCACGAGTAATGAGGATGAGATTGTCATCAGCACGCCGGAGACGCTGACGCTGA
ACGGCGGCGGGTCGTACCTGAAGCTGAGCAAAAGCGGCATTGAGCACGGCTCGCAGGGTGACATGCTGAT
GAAGGTGGCGATGTATCTTGTAACGGGGACGGGGGCAACGCTTCCCCATGAAGCGCCTGAATTCAGCATG
AAAGATATTACTCAGGAAAACACCATGAGCAGCAAAGCTTTTAACGACTGA