SecReT6
Protein ID: 389841196
SecReT6 ID662
T6SS typei2
Gene symbolvasE
Locus tagES15_2196
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2341498..2342847 [-]
Producttype VI secretion system core protein
NoteTssK
UniProt IDI2EJB7
KEGG IDcsk:ES15_2196
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-123, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|389841196|ref|YP_006343280.1| type VI secretion system core protein [Cronobacter sakazakii ES15]
MKIFRPLWNEGALLSPQQFQQQSAWEAFTNAGVLGLSSPFPWGVERVELDDELLASGRIQVRALRLWLPD
GTLVDTLNSDLPPQPRELNPHELAGQDSITLLLALPLMQPGIINVQKASFVSERPLRYREEWVSLPDAFG
PEEESVAVAHFNLSLRFGHESNESWQTCPVSRLVRDGQGGWRQDASFIPPMALFSASAMLQERLVLLNRQ
LRSRRQRLMSMRRESNERLADFAVADVSLFWLLNALNSHARVLSEYERFPARHPEQVWAELARLAGSMLT
FSLEHDLDIIPGYDHAEPEHTFPRLFDLITELLETSLPSRVIALPMTRLDELTWKTSLHDMRLREEADFY
LSVRSDIPAWQIAERFPELCKAGSPDEVNAVSISALNGIPLIPVMRVPAALPVRLENHYFALDMESAAAR
DMLEQGVCMFYVPSLLGALEIELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2342847-2341498 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAAGATATTTCGACCACTGTGGAACGAGGGGGCGCTGCTGTCCCCTCAGCAATTTCAGCAACAGTCTG
CCTGGGAGGCGTTCACCAATGCCGGGGTGTTGGGGCTGTCATCACCGTTTCCGTGGGGCGTAGAGCGCGT
TGAACTGGATGACGAGCTGCTTGCTTCCGGACGTATTCAGGTGCGCGCTCTGCGTTTATGGCTCCCCGAT
GGCACGCTGGTAGATACGCTGAACAGCGACCTTCCGCCGCAACCCCGCGAACTTAACCCCCATGAGCTGG
CAGGGCAAGATAGCATTACTTTGCTGCTGGCTCTGCCACTGATGCAGCCCGGCATTATAAACGTGCAGAA
AGCCTCTTTCGTCTCTGAGCGTCCGTTACGCTACCGCGAGGAGTGGGTTTCACTGCCCGATGCATTTGGA
CCCGAAGAAGAGTCTGTTGCCGTGGCGCACTTTAATCTCTCTTTACGCTTTGGGCATGAAAGTAATGAAT
CCTGGCAAACCTGTCCTGTCAGTCGACTGGTTCGTGACGGGCAAGGCGGCTGGCGACAGGACGCGAGTTT
TATTCCGCCAATGGCGTTATTTTCCGCAAGTGCGATGTTACAGGAGCGTCTGGTGTTGCTGAATCGCCAG
TTGCGCTCCCGCCGCCAGCGATTAATGTCTATGCGTCGTGAAAGCAACGAGCGGCTTGCTGATTTTGCTG
TCGCGGATGTGTCGTTGTTCTGGTTGCTTAATGCCCTGAATTCCCATGCGCGCGTGCTGAGCGAATATGA
ACGCTTTCCGGCACGTCATCCTGAACAGGTCTGGGCTGAACTGGCACGGCTCGCAGGCAGCATGCTGACG
TTTTCACTCGAACACGATCTGGACATTATTCCCGGATACGACCACGCCGAGCCGGAGCACACTTTTCCCC
GTTTATTTGATCTGATAACCGAATTACTGGAAACAAGCCTGCCGTCACGGGTTATCGCGCTGCCAATGAC
ACGGCTGGATGAACTGACCTGGAAAACCTCACTGCATGACATGCGCCTGCGGGAAGAGGCTGATTTCTAT
CTTTCTGTACGATCCGATATTCCTGCCTGGCAAATTGCCGAACGTTTTCCTGAACTCTGTAAAGCTGGCT
CCCCGGATGAAGTAAACGCGGTTTCCATCAGCGCGCTGAATGGCATACCGCTGATTCCGGTGATGCGCGT
GCCTGCTGCGCTGCCGGTGCGCCTGGAAAATCACTATTTTGCGCTGGATATGGAAAGCGCGGCCGCGCGC
GACATGCTGGAGCAGGGCGTATGCATGTTTTATGTACCGTCTCTGCTGGGCGCGCTTGAAATTGAACTGT
TTGCGGTGCTGCGCTCATGA