SecReT6
Protein ID: 389841197
SecReT6 ID662
T6SS typei2
Gene symbolimpC1
Locus tagES15_2197
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2342862..2344403 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDI2EJB8
KEGG IDcsk:ES15_2197
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-174, Aligned region: 88..509
DUF3508 [PF12018], Evalue: 0.0037, Aligned region: 63..142
Protein Sequence: 513 a.a.     [Download]
>gi|389841197|ref|YP_006343281.1| type VI secretion protein [Cronobacter sakazakii ES15]
MLMSVQNTPTAAGATQVQETTGGVYASLFEKINLHPVDALDDIDAWQDSQRLADASADERVTAAVRVFLE
RLKQSGQQVEKLDKTLLDHHIAELDRQISRQLDTVMHHPEFQQVESLWRGLKHLVDRTDYRQNVRTEILD
IAKEDLRQDFEDAPEIIQSGLYWHTYTAEYDTPGGEPVGAVISSYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLTLPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTSASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVRLYAV
PHFQVEGMDVSLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2344403-2342862 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCTGATGTCTGTTCAGAACACCCCCACTGCTGCCGGCGCCACGCAGGTGCAGGAAACCACCGGCGGCG
TCTACGCCTCGCTGTTTGAAAAAATTAACCTTCACCCGGTCGACGCGCTCGATGATATCGACGCCTGGCA
GGACAGCCAGCGCCTGGCGGACGCCTCCGCCGATGAACGCGTGACCGCCGCGGTCCGGGTTTTCCTGGAG
CGCCTGAAACAGTCCGGCCAGCAGGTTGAAAAGCTCGACAAAACGCTGCTTGACCACCATATCGCTGAGC
TGGACCGGCAAATCAGCCGCCAGCTGGATACGGTGATGCACCATCCGGAGTTTCAGCAGGTGGAATCGCT
GTGGCGCGGCCTGAAGCATCTGGTGGATCGCACCGATTACCGCCAGAACGTGCGCACGGAAATTCTCGAT
ATCGCCAAAGAGGATTTGCGCCAGGACTTCGAGGACGCGCCGGAAATTATCCAGAGCGGCCTCTACTGGC
ACACCTACACGGCGGAATATGACACGCCCGGCGGTGAGCCGGTGGGCGCGGTGATTTCCTCGTATGAGTT
TGACGCCAGCGCGCAGGATATGGCGCTGCTGCGTAATATCTCTAAAGTCTCCGCCGCGGCGCACATGCCG
TTTATCGGTGCCGTCGGCCCGAAATTCTTCCTCAAAGATTCCATGGAAGAGGTGGCGGCGATTAAGGACA
TCGGCAACTACTTTGACCGCGCCGAATACATCAAGTGGAAATCCTTCCGCGACACCGACGATGCCCGCTA
TATCGGCCTGACCCTGCCGCGCGTGCTGGGCCGCCTGCCGTACGGCCCGGACACCGTGCCGGTGCGCAGC
TTTAACTATGTGGAAGAGGTGAAAGGGCCGGACCACGAAAAATACCTGTGGACCAGCGCGTCGTTTGCCT
TCGCGGCCAATATGGTGAAGAGCTTCATTAATAACGGCTGGTGCGTGCAGATCCGCGGCCCGCAGGCGGG
CGGCGCGGTGCAGGACCTGCCGATTCATCTCTATGACCTCGGCACCGGCAATCAGGTGAAAATCCCGTCG
GAAGTGATGATCCCGGAGACGCGTGAATTTGAGTTCGCCAGCCTCGGTTTTATCCCGCTCTCCTACTACA
AAAACCGCGACTACGCCTGCTTCTTCTCGGCGAACTCGGCGCAGAAACCGGCGCTGTACGACACGCCGGA
CGCGACGGCCAACAGCCGCATCAACGCGCGCCTGCCGTATATCTTCCTGCTGTCGCGCATCGCGCACTAC
CTGAAGCTGATTCAGCGCGAGAACATCGGCACCACCAAAGACCGCCGTCTGCTGGAGCTGGAGCTGAACA
ACTGGGTGCGCGGGCTGGTGACGGAGATGACTGACCCGGGCGACGAGCTGCAGGCGTCACACCCGCTGCG
CGATGCGAAAGTGGTGGTGGAAGATATCGAAGACAACCCGGGCTTTTTCCGCGTCAGGCTGTACGCCGTG
CCGCATTTCCAGGTGGAAGGCATGGACGTCAGCCTGTCGCTGGTGTCGCAGATGCCAAAAGCGAAGGCGT
GA