SecReT6
Protein ID: 389841198
SecReT6 ID662
T6SS typei2
Gene symbolimpB1
Locus tagES15_2198
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]2344438..2344935 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDI2EJB9
KEGG IDcsk:ES15_2198
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-54, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|389841198|ref|YP_006343282.1| type VI secretion protein [Cronobacter sakazakii ES15]
MSGSFQEEIPKARINLKLNLHTGGAQKKVELPLKLLVTGDFSHGQEHRPLSERKKIDINKNNFDSVLSEF
SPALNLAVENTLAGDGREENVRLTFRQMKDFEPEQVARQIPQLKAMLAMRNLLRDLKSNLLDNATFRREL
ETILKDPALSDGLRAELASLAPKHA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c2344935-2344438 Cronobacter sakazakii ES15 chromosome, complete genome
ATGTCTGGTTCATTTCAGGAAGAAATTCCTAAAGCCCGTATTAACCTGAAGTTAAATCTGCACACCGGCG
GCGCGCAGAAAAAAGTTGAGCTGCCGCTGAAATTACTGGTCACCGGCGATTTCAGTCACGGCCAGGAGCA
CCGGCCGCTGTCTGAGCGCAAAAAAATCGACATAAACAAAAATAATTTCGACAGCGTGCTTTCGGAATTT
TCACCGGCGCTGAATCTCGCCGTGGAAAATACCCTGGCCGGTGACGGGCGCGAAGAAAATGTGCGCCTGA
CCTTCCGCCAGATGAAAGATTTCGAGCCGGAGCAGGTGGCGCGGCAAATTCCCCAGCTGAAAGCCATGCT
CGCGATGCGCAATTTACTGCGCGACCTGAAATCCAATCTCCTTGATAACGCCACCTTCCGCAGGGAGCTG
GAAACCATCCTGAAGGATCCGGCGCTGAGCGATGGCTTACGCGCGGAACTGGCGTCGCTGGCCCCGAAAC
ACGCCTGA