SecReT6
Protein ID: 389841805
SecReT6 ID663
T6SS typei3
Gene symbol-
Locus tagES15_2805
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3020873..3021355 [-]
Producthypothetical protein
NoteTssE
UniProt IDI2EL26
KEGG IDcsk:ES15_2805
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.60E-15, Aligned region: 34..139
Protein Sequence: 160 a.a.     [Download]
>gi|389841805|ref|YP_006343889.1| hypothetical protein ES15_2805 [Cronobacter sakazakii ES15]
MERKKQFAPTLLDRLLDEEPKARHEAHDASFINARRYRQLVLRDIDVLLNNTNIEALIDPVRHPAVVNSV
INHGLAPLSGKYATPQSWTMVEQAIRNALLRFEPRIIPSSLVVSPKRQSAPGTTLWFEIAALLYWQPEPV
GFAVSGSYDTETEKTTLTAL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3021355-3020873 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGAGAGAAAAAAACAGTTCGCGCCGACGCTACTTGACCGGCTGCTGGATGAGGAGCCAAAAGCCCGCC
ACGAAGCGCATGACGCGAGTTTTATTAATGCGCGTCGCTACCGGCAGTTAGTGCTGCGCGATATTGATGT
GTTGCTCAACAACACCAATATTGAAGCGCTCATCGACCCGGTGCGACACCCGGCGGTGGTTAATTCGGTG
ATTAATCACGGCCTCGCGCCGCTCTCCGGGAAATATGCGACGCCGCAAAGCTGGACGATGGTAGAGCAGG
CTATCCGCAACGCATTATTGCGCTTTGAGCCGCGTATTATCCCGTCATCGCTGGTGGTAAGTCCGAAGCG
GCAGTCCGCGCCGGGTACAACGCTGTGGTTTGAAATAGCGGCGTTGCTTTACTGGCAACCGGAACCCGTC
GGGTTTGCGGTTAGCGGCAGTTATGATACCGAAACGGAAAAAACGACGCTGACGGCGTTATAG