SecReT6
Protein ID: 389841806
SecReT6 ID663
T6SS typei3
Gene symbolimpE1
Locus tagES15_2806
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3021365..3022162 [-]
ProductImpE family protein
NoteTagJ
UniProt IDI2EL27
KEGG IDcsk:ES15_2806
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.90E-44, Aligned region: 145..264
Protein Sequence: 265 a.a.     [Download]
>gi|389841806|ref|YP_006343890.1| ImpE family protein [Cronobacter sakazakii ES15]
MTTEITFKDLLNRAAFDAHFNATTSRLKAQPDNSAARELLFKFYCLEGDWHNALTHLEILKALDAEYTKR
VELYKNLVMSEILRARVLAGDITPAGLTEPLPEWVELLHEANRQFASGHDEDAERLRQQAFDLAPLTAGE
GEEITPFSWMADSDGRLGPVCEFICAGGYRWVPFSALRALKIHRPVDLLDLLWLPAQMTLADGQFQGYIP
ARYPLTPQATQETRLGSLTDWQPVSESLCIGLGRKMLITDNADYALPDLRELRFY
 
Nucleotide Sequence: 798 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3022162-3021365 Cronobacter sakazakii ES15 chromosome, complete genome
ATGACGACAGAAATCACGTTTAAGGACTTACTTAATCGCGCGGCGTTTGACGCCCATTTCAACGCAACGA
CGAGCCGCTTAAAAGCGCAGCCTGATAACAGCGCGGCGCGCGAATTGCTGTTTAAATTTTATTGTCTCGA
AGGCGACTGGCATAACGCTCTGACGCACCTGGAGATACTGAAAGCGCTCGATGCGGAATATACAAAGCGG
GTGGAGCTTTATAAAAATCTCGTTATGAGCGAAATATTACGCGCCCGCGTGCTGGCCGGTGACATTACGC
CTGCGGGGCTTACGGAGCCGCTGCCGGAATGGGTCGAGCTGCTTCATGAGGCGAACCGGCAGTTCGCTTC
CGGTCATGACGAGGACGCCGAACGCCTTCGTCAGCAGGCATTCGACCTGGCACCGCTTACGGCGGGCGAA
GGCGAGGAGATAACCCCGTTTAGCTGGATGGCCGACAGCGACGGGCGGCTCGGGCCCGTGTGCGAATTTA
TCTGTGCGGGAGGGTACCGCTGGGTGCCGTTTTCCGCGCTGCGTGCGCTGAAGATCCACCGTCCCGTTGA
CCTGCTGGATCTGCTCTGGCTGCCTGCGCAAATGACCCTCGCTGACGGGCAGTTTCAGGGCTATATCCCA
GCTCGCTACCCGCTGACGCCGCAAGCGACGCAGGAAACCCGCCTCGGCAGCCTGACCGACTGGCAGCCGG
TCAGCGAGTCGCTCTGTATCGGGCTTGGCAGAAAGATGCTGATTACCGATAACGCGGACTATGCGCTGCC
GGATCTGCGTGAGCTTCGGTTTTATTAA