SecReT6
Protein ID: 389841809
SecReT6 ID663
T6SS typei3
Gene symbol-
Locus tagES15_2809
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3023290..3025725 [-]
Producthypothetical protein
NoteTssI
UniProt IDI2EL30
KEGG IDcsk:ES15_2809
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-77, Aligned region: 29..349
Phage_base_V [PF04717], Evalue: 2.20E-26, Aligned region: 386..479
Protein Sequence: 811 a.a.     [Download]
>gi|389841809|ref|YP_006343893.1| hypothetical protein ES15_2809 [Cronobacter sakazakii ES15]
MSRTTQLLSPAMPYLAGEPALVLSKLTGEEALSTLYTYTLTAKTPANAAISWQAASNIDFKALVGKEMTV
AMEIDGNGLDETAGLGRGRREISGLVERARYIGRDANQAMFEIEIRPWLYLATLTSDFKIFQNKNVVEII
DEVLAEYSFPCEKRLTGTYPSLDFQVQYGETDFSFIQRLMEEWGIYWFFEHKDEKHKLILVDHVGAHKRV
DSAAYHVLHYLPETPKAGEEYIAHFAPQETITTGRWVTNDYDFTKSRADILALDSKPRNTSFNQMEMYHW
PGDYAQPNIGEQLARVRMEERGALGSRATGDGELRGVVCGCNFVLSGYPVEKANREYLVISSRLDIEDNA
QVSGFEDYRWHCHFVVQPTNKIYRHPLHTPRPRTRGPQTAIVVGPPGEEVWTDKYGRVKVRFVWDRYGKN
RESDSCWLRVSQSWAGNNFGGIYIPRIGHEVIVDFINGDPDRPLIIGSLYNNITMPPWDLPGNATQSGMI
SRTIGGGRTNFNGIRFEDKPGLEQYWEQAERNMERLTKKDETQTIGENSKLSVGLNRDVFVGANYVKKIL
GGCRKLIGLGAFMQVGLTREVMVGGAQAHHIGGANSLNVGGADLTNVGGYSGTSVGGAWQVAAGGAATVA
AGGAMSLSSGGELIISADTIKIIGSSKVVIQGGQVQLNPGDGGCSCGNSSGGGMGALASLAGLMPLMGIM
VLPLPLPPLPIPIPIPVPIPTHCPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTDTPTD
TPTDTPTDTPTDTPTETPTDTPTETPTETPTETQTAPPKFW
 
Nucleotide Sequence: 2436 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3025725-3023290 Cronobacter sakazakii ES15 chromosome, complete genome
ATGTCGCGTACAACGCAATTACTCAGCCCGGCGATGCCTTATCTTGCCGGTGAGCCGGCTTTAGTGCTTT
CTAAATTAACCGGAGAAGAAGCGCTCTCCACGTTATATACCTACACCCTTACCGCGAAAACGCCCGCGAA
TGCCGCTATTTCCTGGCAGGCGGCATCGAATATCGATTTCAAAGCCCTTGTGGGTAAAGAAATGACGGTC
GCGATGGAAATCGACGGTAACGGGCTTGATGAAACGGCAGGTCTCGGTCGCGGGCGGCGCGAAATATCGG
GCCTGGTGGAGCGCGCGCGTTATATCGGGCGAGACGCGAATCAGGCGATGTTTGAAATAGAGATTCGCCC
GTGGCTGTATCTCGCGACGCTTACCAGCGATTTCAAAATTTTCCAGAATAAAAACGTGGTGGAAATCATT
GATGAGGTGCTCGCCGAATATTCTTTCCCTTGTGAGAAACGTCTGACGGGTACTTATCCGTCTCTCGATT
TTCAGGTGCAATATGGCGAAACGGATTTCAGTTTTATTCAGCGCTTAATGGAAGAGTGGGGGATTTACTG
GTTTTTTGAGCATAAAGACGAGAAGCATAAGTTAATTCTTGTCGATCATGTGGGCGCGCATAAACGCGTC
GACAGCGCCGCCTATCACGTTTTGCATTATTTACCCGAAACGCCAAAAGCGGGTGAAGAGTATATTGCCC
ACTTCGCGCCGCAGGAAACCATTACCACCGGCCGCTGGGTCACTAACGATTACGATTTTACGAAATCTCG
TGCCGATATTCTGGCGCTCGACAGCAAGCCGCGTAACACCAGCTTTAACCAGATGGAGATGTATCACTGG
CCTGGCGATTACGCACAGCCAAATATTGGCGAACAGCTGGCGCGGGTGCGCATGGAAGAGCGGGGCGCTC
TGGGCTCACGCGCGACAGGCGACGGCGAACTTCGGGGCGTCGTCTGCGGCTGTAATTTTGTGTTAAGCGG
CTATCCCGTTGAGAAAGCCAACCGGGAATATCTGGTTATTTCCAGCAGGCTTGATATCGAGGACAACGCT
CAGGTAAGCGGTTTTGAAGATTATCGCTGGCACTGCCATTTTGTCGTTCAGCCGACCAATAAAATTTATC
GTCACCCCCTGCACACGCCACGGCCACGCACGCGCGGGCCGCAGACGGCGATTGTCGTCGGACCGCCTGG
CGAAGAGGTCTGGACGGACAAATATGGCCGCGTGAAAGTACGGTTTGTCTGGGATCGTTACGGTAAAAAC
CGTGAATCAGATTCCTGTTGGCTGCGCGTCAGTCAGTCATGGGCAGGCAATAACTTTGGCGGCATTTATA
TTCCCCGCATCGGGCATGAAGTGATTGTCGATTTCATCAACGGTGACCCGGACCGGCCGCTGATTATTGG
CAGTCTGTATAACAACATTACGATGCCGCCGTGGGATCTGCCGGGTAATGCCACGCAAAGCGGCATGATA
AGCCGCACTATCGGCGGCGGGCGCACCAATTTCAACGGGATCCGCTTTGAGGATAAACCCGGTCTTGAGC
AGTACTGGGAGCAGGCCGAGCGCAATATGGAACGCCTGACGAAAAAAGATGAAACCCAGACGATTGGCGA
AAATTCAAAACTTTCTGTGGGCCTGAACCGGGATGTCTTTGTCGGTGCGAATTACGTTAAAAAAATCCTC
GGTGGCTGCCGCAAACTGATTGGGCTTGGCGCTTTTATGCAGGTCGGGCTGACGCGCGAGGTGATGGTCG
GCGGCGCGCAGGCGCACCATATTGGCGGCGCGAATTCTCTTAACGTTGGGGGAGCGGATCTCACAAACGT
TGGCGGCTACAGCGGCACCTCCGTGGGCGGCGCGTGGCAGGTGGCCGCGGGCGGCGCGGCGACAGTGGCC
GCAGGCGGTGCCATGTCGCTGAGCTCTGGCGGGGAGCTGATTATTTCAGCCGATACGATCAAAATTATTG
GCAGCAGTAAGGTGGTGATACAAGGGGGCCAGGTACAGCTCAACCCTGGCGATGGCGGGTGTTCCTGCGG
TAACAGCAGCGGTGGCGGTATGGGCGCACTGGCAAGCCTTGCGGGGCTGATGCCGCTGATGGGGATTATG
GTTTTACCGCTGCCTCTGCCGCCACTGCCTATTCCTATTCCCATTCCTGTTCCCATCCCGACGCATTGTC
CGACGGATACGCCAACCGATACGCCGACGGATACGCCGACAGATACACCAACGGATACACCGACCGATAC
ACCAACGGATACGCCAACCGATACGCCAACGGATACGCCGACGGATACGCCGACGGATACGCCGACGGAT
ACGCCGACCGATACGCCGACGGATACGCCGACCGATACGCCAACGGAAACGCCAACCGATACACCGACGG
AAACGCCGACCGAAACGCCAACGGAGACGCAAACGGCGCCGCCCAAATTCTGGTAA