SecReT6
Protein ID: 389841814
SecReT6 ID663
T6SS typei3
Gene symbolimpK1
Locus tagES15_2814
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3030220..3031563 [-]
ProductOmpA/MotB family protein 1
NoteTssL
UniProt IDI2EL35
KEGG IDcsk:ES15_2814
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-56, Aligned region: 75..280
OmpA [PF00691], Evalue: 2.20E-18, Aligned region: 341..439
Protein Sequence: 447 a.a.     [Download]
>gi|389841814|ref|YP_006343898.1| OmpA/MotB family protein 1 [Cronobacter sakazakii ES15]
MSTMDAFTSGDEALNLQALGKFLVDEQGDTFGSSPSFSDPFSNEKAPVSGRRYHARIKTESIQQRVAKVR
AAQIPLLEAALPLLRALSEMPETIPVIADVELLKDILRHEITLFSVVCDEADIPWKKMAIVRYCLCTALD
EAAHGTSWGLQSGWSQSNLLNHFEGDNDGGNKFFLLVGRLSASPHEFPDVLEIMLHILGLGFEGRYSIID
DGERQLTRIRQRLLTLLQSTRETLPPALSPHAYCEGQAARKSFFFIPVKVSLALCALLVAALFLGCKYYL
SLPQELFREQLLAMQRLHITEPRPPERLRLAVLLKAEIARHWVSVDESQRESRVIFHGDSMFAVGDASVR
PERIDIIRRVAAEVQRVNGEVVIIGHTDSTPIRSGAFASNQALSEKRAQAVAAYFREQGIAPEKITSKGA
GDTQPIASNHDAQGRSQNRRVEIFVTY
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3031563-3030220 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAGCACAATGGATGCGTTCACGTCTGGTGATGAAGCGCTTAACCTCCAGGCATTAGGGAAATTTCTGG
TAGATGAACAAGGCGATACATTCGGGTCATCCCCTTCGTTTTCTGATCCTTTCAGCAATGAGAAAGCCCC
TGTCTCAGGGCGGCGTTATCACGCGCGTATCAAAACCGAGAGCATTCAACAGCGCGTCGCGAAAGTGCGC
GCTGCGCAGATCCCGTTGCTGGAGGCCGCGCTGCCGCTATTGCGCGCGCTCAGTGAGATGCCGGAAACCA
TTCCGGTAATCGCTGATGTGGAGTTGCTGAAAGATATCCTCAGGCACGAAATCACGCTATTTAGCGTGGT
GTGCGATGAAGCCGATATCCCCTGGAAAAAGATGGCCATCGTGCGTTATTGCCTCTGCACCGCGCTGGAT
GAGGCCGCGCATGGAACGAGCTGGGGGCTTCAGTCTGGCTGGTCGCAAAGCAACCTGCTCAATCATTTTG
AAGGGGACAATGACGGCGGCAATAAATTCTTTCTGCTGGTAGGCAGGCTCTCCGCCAGTCCTCATGAATT
CCCGGATGTGCTGGAAATCATGCTGCATATTCTGGGGCTGGGCTTTGAAGGGCGCTACAGCATCATTGAC
GATGGCGAACGCCAGCTGACCCGCATTCGCCAGCGGCTGCTAACGCTTCTCCAGAGCACTCGCGAGACGC
TGCCTCCGGCGCTTTCCCCTCATGCGTATTGCGAGGGGCAGGCAGCCCGAAAATCGTTTTTTTTCATTCC
GGTGAAAGTATCGCTGGCGCTCTGCGCTTTGCTGGTCGCCGCGCTTTTTCTTGGCTGCAAATATTACCTG
TCCCTGCCGCAGGAGTTATTCCGCGAGCAGTTACTGGCGATGCAGCGTTTGCATATCACTGAGCCGCGTC
CGCCGGAGCGTTTACGCCTTGCGGTTCTGCTGAAAGCGGAAATTGCCCGCCACTGGGTCAGCGTGGATGA
GTCACAGCGGGAAAGCCGGGTCATCTTTCATGGCGATTCTATGTTTGCTGTCGGCGACGCCAGCGTCAGG
CCGGAGCGGATTGACATCATTCGTCGCGTCGCCGCTGAAGTGCAGCGGGTGAATGGTGAGGTGGTGATTA
TCGGCCATACCGATTCGACGCCCATTCGCAGCGGGGCGTTTGCCAGCAACCAGGCGCTTTCAGAAAAACG
GGCGCAGGCGGTAGCCGCGTATTTCCGGGAGCAAGGCATCGCGCCTGAGAAAATCACATCAAAAGGGGCC
GGAGATACACAGCCGATCGCCAGTAATCACGATGCGCAGGGACGTTCACAAAACCGACGCGTTGAAATTT
TTGTGACTTATTAA