SecReT6
Protein ID: 389841815
SecReT6 ID663
T6SS typei3
Gene symbolimpJ1
Locus tagES15_2815
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3031563..3032909 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDI2EL36
KEGG IDcsk:ES15_2815
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-141, Aligned region: 19..447
Protein Sequence: 448 a.a.     [Download]
>gi|389841815|ref|YP_006343899.1| type VI secretion protein [Cronobacter sakazakii ES15]
MRTNKVIWSEGLFLRPQLFQQQERYLEYFSHKRAATITPFFWGFSRYSIDKEALAYGKFVLHSGSGVFPD
GTPFDIPEHAAPPEPLTVRPEHLGQLIFLAVPLRLENSDETIFDAHDASSLARFCAFETPLNDANAIRQG
PKPVQLGRLRLMLVPESEMTESWIGLPLARIRAIQPDGSVLLHENDYIPPVTCCAANTLLNEWVTHLNGL
VKLRAEMLAGRLSNSDGKASASAEIVDYLLLQIFNKYEPVLDHLRHVPELPPIVLYQELAKFAGELSTFI
RTKTRRPQPAPGYDHARLYTSIRPLVDDVHELLNQILIRAGQVIPLHAKGNGVWSAVVLPGELRTFASLV
LAVNAQLPADVLQQHFSAQAKISAPQQLHELVRSHLPGLELLALPVPPRQIPYNAGHVYFELQKSGTFWD
AITVAGALAMHVAGEFPGLKMELWGIRD
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3032909-3031563 Cronobacter sakazakii ES15 chromosome, complete genome
GTGAGAACGAATAAAGTTATCTGGAGTGAAGGCCTGTTTTTACGTCCGCAGCTGTTTCAGCAGCAGGAGC
GGTATCTGGAATATTTCTCGCATAAGCGAGCAGCCACTATCACTCCCTTTTTCTGGGGATTTTCACGCTA
CAGTATTGATAAAGAAGCGCTCGCCTACGGTAAGTTTGTTCTGCATTCCGGCAGCGGCGTCTTTCCTGAT
GGCACCCCTTTCGATATCCCGGAGCATGCGGCTCCGCCCGAGCCGTTAACGGTTCGCCCTGAACACTTAG
GCCAGCTGATTTTTCTGGCCGTGCCGCTGCGGCTCGAAAACAGTGATGAAACTATTTTTGATGCACATGA
TGCCAGTTCGCTTGCGCGCTTTTGCGCTTTTGAAACGCCCCTGAACGATGCCAACGCCATTCGCCAGGGG
CCGAAACCCGTTCAGCTTGGGCGGCTGCGCCTCATGCTGGTGCCTGAAAGCGAAATGACGGAGTCGTGGA
TCGGTTTACCACTGGCCCGCATACGCGCCATTCAGCCTGATGGCAGCGTGCTGTTGCATGAGAATGATTA
TATTCCCCCGGTGACATGCTGTGCGGCCAACACATTGCTCAATGAGTGGGTAACGCATCTCAACGGACTC
GTTAAATTGCGCGCCGAAATGCTGGCGGGTCGGTTGTCAAACAGCGATGGCAAAGCCAGCGCCAGCGCTG
AAATCGTCGATTACCTTTTGCTGCAAATATTCAATAAATACGAACCGGTGCTGGATCATCTGCGCCATGT
GCCTGAGCTGCCGCCGATTGTCCTGTATCAGGAGCTCGCGAAGTTTGCCGGTGAATTATCTACCTTCATT
CGCACTAAAACGCGTCGGCCCCAGCCAGCGCCGGGTTACGACCATGCGCGACTGTATACCAGCATCCGGC
CGCTGGTGGACGATGTGCATGAACTGCTGAACCAGATCCTTATCCGCGCCGGGCAGGTTATTCCTCTGCA
TGCGAAAGGTAACGGCGTCTGGAGCGCGGTGGTGTTGCCTGGCGAATTGCGCACCTTCGCAAGCCTGGTA
CTGGCCGTGAATGCGCAACTGCCGGCAGATGTTCTTCAGCAGCATTTTTCCGCGCAAGCGAAAATCAGTG
CGCCTCAGCAGTTGCATGAACTGGTGCGTTCACACTTGCCGGGTCTGGAATTGCTGGCGCTACCGGTGCC
GCCGCGACAGATCCCCTATAACGCCGGTCATGTCTATTTTGAGCTTCAGAAAAGCGGCACATTCTGGGAT
GCCATCACCGTCGCCGGAGCACTGGCGATGCACGTTGCCGGTGAGTTTCCAGGCCTCAAGATGGAACTGT
GGGGGATCCGTGACTGA