SecReT6
Protein ID: 389841816
SecReT6 ID663
T6SS typei3
Gene symbolvasD2
Locus tagES15_2816
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3032896..3033303 [-]
Producttype VI secretion lipoprotein, VC_A0113 family 1
NoteTssJ
UniProt IDI2EL37
KEGG IDcsk:ES15_2816
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.90E-26, Aligned region: 1..124
Protein Sequence: 135 a.a.     [Download]
>gi|389841816|ref|YP_006343900.1| type VI secretion lipoprotein, VC_A0113 family 1 [Cronobacter sakazakii ES15]
MNPNRRGVASPLKVTVYALNDDEAFLDAGFLTITESPDPELKKEMQQLWEGILRPGEKKQVTVVTDDTAH
ALGIVAAYRDIQKAQWSATSPLPEKLSVSWYQALWPWHTEAPAQPVEITFDKLNITIKGLNRENE
 
Nucleotide Sequence: 408 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3033303-3032896 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAACCCGAATCGTCGGGGCGTGGCGAGCCCGCTAAAAGTAACGGTATATGCGCTCAATGATGATGAGG
CGTTTCTGGATGCCGGTTTCCTGACGATCACCGAATCGCCCGATCCCGAATTGAAAAAAGAGATGCAGCA
ACTCTGGGAAGGCATATTGCGACCGGGGGAGAAGAAACAGGTCACCGTCGTGACGGACGATACAGCCCAT
GCGCTTGGGATTGTCGCTGCCTATCGCGATATTCAAAAGGCGCAGTGGAGTGCCACCTCACCACTGCCTG
AAAAGCTGTCTGTGAGCTGGTATCAGGCGCTCTGGCCGTGGCACACCGAAGCGCCTGCGCAACCTGTTGA
AATAACTTTCGATAAATTAAACATCACAATCAAGGGATTGAATCGTGAGAACGAATAA