SecReT6
Protein ID: 389841817
SecReT6 ID663
T6SS typei3
Gene symbolhcp2
Locus tagES15_2817
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3033608..3034093 [-]
Producttype VI secretion system effector, Hcp1 family 2
NoteTssD
UniProt IDI2EL38
KEGG IDcsk:ES15_2817
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.60E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|389841817|ref|YP_006343901.1| type VI secretion system effector, Hcp1 family 2 [Cronobacter sakazakii ES15]
MAQDMFIKIDGIEGESLDATHKNEIQVLAWHWSVSQHSNMHSGSGGGSGKATVADFCFEHYVDKATPNLV
SYCLTGKHIKNIQFVIRKAGGDPLEYLLIKFTDVIITGVDVMGSLEDETRPRESVRFSFTKMTEDYVMQN
AEGQKAGVISASYDVKANLHG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3034093-3033608 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGCACAGGATATGTTTATTAAAATTGATGGCATCGAAGGGGAGTCATTAGATGCCACTCATAAAAACG
AAATTCAGGTTTTGGCATGGCACTGGAGTGTCTCACAGCACTCCAATATGCACAGCGGTTCTGGTGGTGG
TTCCGGTAAGGCGACTGTCGCTGATTTCTGCTTTGAACATTATGTCGATAAGGCGACACCGAATCTGGTG
AGCTACTGTCTGACCGGTAAACATATTAAAAACATCCAGTTTGTTATTCGTAAAGCGGGCGGAGATCCGC
TCGAATATCTGCTGATTAAATTCACGGATGTCATTATTACCGGCGTGGATGTAATGGGATCGCTGGAAGA
TGAAACACGTCCGCGTGAATCAGTGCGCTTCTCATTTACCAAAATGACCGAAGATTATGTGATGCAGAAT
GCGGAAGGTCAAAAAGCAGGCGTTATTTCTGCCAGCTATGACGTTAAAGCTAACCTGCACGGCTAA