SecReT6
Protein ID: 389841819
SecReT6 ID663
T6SS typei3
Gene symbol-
Locus tagES15_2819
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3035771..3036301 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDI2EL40
KEGG IDcsk:ES15_2819
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-59, Aligned region: 11..164
Protein Sequence: 176 a.a.     [Download]
>gi|389841819|ref|YP_006343903.1| type VI secretion protein [Cronobacter sakazakii ES15]
MVNKSNSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPLEPLLAVADRKFLDIDIDNF
DERMKAMKPRVAISVPNTLSGEGQLMVDISFESMDDFSPDAIAKKAEPLAQLLEARTQLATLQTYMDGKA
GAEGLVMQLLNDKSLLKTLASSPKPQQASAEVEREE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3036301-3035771 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGTAAATAAAAGTAATTCACAGAAATTTATAGCCAGGAACCGGGCGCCGCGCGTACAAATTGAGTACG
ATGTGGAAATTTATGGCAGTGAAAAAAAGATTGAGCTCCCTTTCGTCATGGGCGTACTGGCGGATTTATC
CGGTAAGCCACTGGAGCCATTGCTGGCTGTCGCGGACAGAAAGTTTCTGGACATCGACATCGATAATTTC
GATGAACGCATGAAAGCGATGAAACCGCGCGTAGCTATTAGCGTCCCGAATACGCTTTCCGGCGAAGGAC
AGCTGATGGTGGATATTTCCTTTGAAAGTATGGATGACTTTTCGCCAGACGCTATTGCGAAGAAAGCGGA
GCCGTTAGCGCAATTGCTGGAGGCCCGCACGCAATTGGCGACGCTGCAAACTTATATGGATGGTAAAGCT
GGCGCAGAAGGACTGGTCATGCAGTTACTTAACGATAAATCCTTATTAAAAACATTAGCTTCCTCGCCGA
AACCGCAGCAGGCTTCAGCGGAAGTCGAGCGGGAAGAGTAA