SecReT6
Protein ID: 389841825
SecReT6 ID663
T6SS typei3
Gene symbolclpB2
Locus tagES15_2825
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3041099..3043792 [-]
ProductClp ATPase chaperone protein ClpB
NoteTssH
UniProt IDI2EL46
KEGG IDcsk:ES15_2825
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.30E-42, Aligned region: 230..314
AAA_2 [PF07724], Evalue: 7.30E-42, Aligned region: 617..784
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 4.20E-21, Aligned region: 623..707
ClpB_D2-small [PF10431], Evalue: 2.90E-15, Aligned region: 475..485
ClpB_D2-small [PF10431], Evalue: 2.90E-15, Aligned region: 544..563
ClpB_D2-small [PF10431], Evalue: 2.90E-15, Aligned region: 790..862
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 232..311
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 622..740
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 209..249
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 271..312
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 490..541
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 612..661
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 687..710
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 364..398
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 620..642
AAA_22 [PF13401], Evalue: 4.70E-08, Aligned region: 684..709
Sigma54_activat [PF00158], Evalue: 6.60E-08, Aligned region: 228..253
Sigma54_activat [PF00158], Evalue: 6.60E-08, Aligned region: 622..727
AAA_19 [PF13245], Evalue: 1.90E-07, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 1.90E-07, Aligned region: 551..563
AAA_19 [PF13245], Evalue: 1.90E-07, Aligned region: 618..644
AAA_14 [PF13173], Evalue: 2.50E-06, Aligned region: 232..322
AAA_14 [PF13173], Evalue: 2.50E-06, Aligned region: 621..703
AAA_25 [PF13481], Evalue: 6.60E-06, Aligned region: 232..309
AAA_25 [PF13481], Evalue: 6.60E-06, Aligned region: 616..648
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 232..300
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 504..536
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 623..651
AAA_18 [PF13238], Evalue: 3.50E-05, Aligned region: 803..817
Arch_ATPase [PF01637], Evalue: 7.70E-05, Aligned region: 211..245
Arch_ATPase [PF01637], Evalue: 7.70E-05, Aligned region: 284..381
Arch_ATPase [PF01637], Evalue: 7.70E-05, Aligned region: 620..664
Arch_ATPase [PF01637], Evalue: 7.70E-05, Aligned region: 693..716
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 224..251
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 619..633
NACHT [PF05729], Evalue: 0.00027, Aligned region: 37..74
NACHT [PF05729], Evalue: 0.00027, Aligned region: 232..260
NACHT [PF05729], Evalue: 0.00027, Aligned region: 623..646
IstB_IS21 [PF01695], Evalue: 0.00037, Aligned region: 215..251
IstB_IS21 [PF01695], Evalue: 0.00037, Aligned region: 622..642
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 54..74
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 233..250
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 375..400
AAA_17 [PF13207], Evalue: 0.00046, Aligned region: 622..660
AAA_30 [PF13604], Evalue: 0.0012, Aligned region: 230..254
AAA_30 [PF13604], Evalue: 0.0012, Aligned region: 619..645
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 232..251
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 471..520
Zeta_toxin [PF06414], Evalue: 0.0021, Aligned region: 621..662
T2SE [PF00437], Evalue: 0.0024, Aligned region: 218..249
T2SE [PF00437], Evalue: 0.0024, Aligned region: 619..700
UPF0079 [PF02367], Evalue: 0.003, Aligned region: 232..254
UPF0079 [PF02367], Evalue: 0.003, Aligned region: 617..645
Protein Sequence: 897 a.a.     [Download]
>gi|389841825|ref|YP_006343909.1| Clp ATPase chaperone protein ClpB [Cronobacter sakazakii ES15]
MAISRKNLFSKLGDTLFRSIESATTLCKLRGNPYVELVHWINQLWHQEDNDLKHVARYFNVDCESLDREL
ARSLNHLPDGATAVADFSYLIELAIERAWMYTSLEHSESKIRSGHLLIALLTSVELRRALLAIAAPLEKI
VLEQFNRDFNYITRNSPEVKESESTVFLSSQNAMPGEASGAIKLQGSGSLAQYATDLTALAREGKIDPVL
GRDREISTMIDILLRRRQNNPLLTGDAGVGKTAVVEGLALAISAGEVPPSLAEVRLMSLDIVALSAGASM
KGEFEARLKAVLEEAASSEQPVILFIDEVHNLVGAGNTAGTGDAANLLKPALARGQLRTIGATTWSEFKR
HIEKDPALTRRFQVLQVEEPDEDNATEMLRGLVPVLEAHHNVWVLEEALRAAVKLSHRYIPARQLPDKAI
SLLDTACVRVAVGQYAPPQMLQDLKYQTESAKRQLSLAVKASTLGKGNEASVNALKRVITQKIKEADSFE
SRWQQEKNIVSEINALRATLQNHCQQENVDDEQQAALKKALLQAEGQLNRVRGEQTMIHTEVSANVVAAI
VSEWTGVPIGQMLQDEMNIVRELPLHLAERVTGQPFALKQISERILMARAGLADPGRPTGVFMLTGPSGT
GKTETALVIAEKMYGGEHNLITINMSEYQEAHTVSALKGSPPGYIGYGEGGVLTEAVRRKPYSVILLDEI
EKAHPDVHELFFQVFDKGRMEDGEGRLIDFRNTIILLTSNVGSEKLISLSRDENTLPEEKRLAELLHTEL
LKFFPAAFLGRLTVIPYLPLRREALGFIINTQLKRVAKRLYENHKVTLEYSDEVINYIIDQCHVSDTGAR
VLIRYIEQNILPQIGGILMNNAQKAKLSGVTISTGTECLLVAPYCEDDIEEKSTTVQ
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c3043792-3041099 Cronobacter sakazakii ES15 chromosome, complete genome
GTGGCTATCTCAAGGAAGAATCTTTTTTCAAAGCTGGGTGACACGCTCTTCAGAAGTATTGAAAGCGCAA
CGACGCTCTGTAAGTTACGCGGTAATCCTTATGTGGAGCTGGTCCATTGGATTAATCAGCTCTGGCACCA
GGAAGATAACGATCTCAAGCATGTCGCACGTTATTTCAATGTTGACTGCGAATCCCTGGATCGTGAGTTA
GCGCGTTCTCTTAATCATTTACCTGATGGCGCAACAGCGGTCGCAGATTTTTCTTATCTTATTGAGCTGG
CGATTGAACGGGCCTGGATGTATACCAGTCTTGAGCATTCTGAAAGTAAAATACGTAGCGGACATCTTTT
AATAGCGTTGCTGACGTCTGTAGAACTTCGCCGTGCTTTATTAGCGATTGCTGCGCCACTGGAGAAAATT
GTACTCGAGCAATTCAATCGCGATTTCAACTATATCACCCGCAATTCACCTGAAGTAAAAGAGAGCGAAT
CGACGGTATTTCTTAGCAGCCAGAATGCTATGCCGGGTGAAGCCAGCGGCGCTATCAAATTACAAGGCAG
TGGCAGCCTTGCTCAATATGCAACCGACCTCACCGCGCTTGCCAGAGAAGGAAAGATTGACCCTGTGCTG
GGCCGCGATCGCGAAATCAGCACAATGATCGATATCCTTCTGCGTCGCCGTCAAAACAATCCCTTACTGA
CCGGAGACGCTGGCGTTGGCAAAACGGCTGTCGTCGAAGGGCTGGCGCTCGCCATTAGCGCAGGTGAAGT
GCCTCCTTCGCTCGCTGAGGTGCGCTTAATGAGCCTGGATATCGTGGCGCTTTCTGCAGGGGCCAGTATG
AAAGGCGAATTCGAAGCGCGTCTTAAAGCTGTGCTGGAAGAAGCGGCCTCTTCTGAGCAACCGGTCATTT
TATTTATTGATGAGGTACATAATCTGGTCGGCGCGGGAAATACCGCAGGGACCGGCGATGCAGCAAATTT
ACTGAAGCCAGCGTTAGCCCGTGGTCAGTTAAGGACAATCGGAGCAACGACCTGGAGTGAATTTAAACGA
CATATTGAAAAAGATCCTGCGCTGACACGTCGTTTTCAGGTGTTGCAGGTAGAGGAGCCTGATGAGGACA
ATGCCACGGAAATGTTGCGTGGTCTGGTGCCGGTGCTGGAAGCGCATCATAACGTCTGGGTTTTAGAAGA
AGCATTACGCGCAGCCGTAAAACTCTCGCATCGTTATATCCCCGCCAGGCAGTTACCTGACAAAGCGATC
AGTTTGCTGGATACGGCCTGCGTCAGAGTTGCCGTAGGGCAATATGCGCCCCCGCAAATGTTGCAGGATT
TAAAATACCAGACGGAATCTGCAAAAAGGCAGCTTTCGCTGGCCGTTAAAGCCAGTACGCTTGGTAAAGG
TAATGAGGCATCTGTTAATGCATTAAAGCGCGTTATCACACAGAAGATTAAAGAAGCCGATTCGTTTGAA
TCGCGTTGGCAGCAGGAAAAAAATATTGTTAGCGAAATTAATGCGCTGCGAGCCACGCTACAGAATCATT
GCCAGCAGGAAAACGTCGATGACGAACAGCAAGCAGCGTTAAAAAAGGCACTTTTACAGGCAGAGGGTCA
GCTTAATCGGGTTCGTGGTGAACAGACGATGATTCACACGGAGGTTAGCGCAAATGTCGTTGCCGCTATT
GTAAGTGAATGGACAGGTGTTCCGATTGGCCAGATGCTTCAGGATGAGATGAATATTGTCCGCGAACTTC
CTTTGCATCTTGCTGAACGTGTCACCGGCCAGCCTTTTGCGCTTAAGCAAATTAGTGAGCGTATTTTAAT
GGCCCGTGCAGGCCTGGCGGATCCTGGCCGTCCGACAGGCGTCTTTATGCTGACGGGGCCGTCCGGGACC
GGTAAAACGGAAACCGCGCTGGTCATTGCGGAAAAAATGTATGGCGGCGAGCATAATCTCATTACTATTA
ATATGAGTGAGTATCAGGAAGCGCATACCGTATCCGCTTTAAAAGGATCACCGCCGGGATATATTGGTTA
TGGTGAAGGAGGCGTTCTTACCGAAGCGGTTCGCCGTAAACCTTATAGCGTTATTTTGCTGGATGAGATT
GAAAAAGCCCATCCTGATGTGCATGAGTTGTTTTTCCAGGTTTTTGATAAAGGACGGATGGAAGATGGCG
AGGGCCGATTAATTGATTTTCGTAATACCATCATCCTGTTAACAAGCAATGTGGGTAGTGAAAAGCTAAT
ATCGTTATCGCGTGATGAAAATACATTACCTGAAGAGAAAAGGCTGGCAGAACTACTGCATACTGAATTA
TTAAAATTTTTCCCTGCTGCATTTCTCGGCCGGCTAACGGTAATTCCTTATCTCCCTTTGAGGCGAGAAG
CATTAGGATTCATTATAAATACTCAGCTTAAGCGAGTGGCAAAGCGTCTTTATGAAAATCATAAAGTAAC
GCTTGAATATAGCGATGAAGTGATTAACTACATTATTGACCAATGCCACGTATCCGATACCGGTGCGAGA
GTGTTAATTCGTTATATCGAGCAGAATATTTTACCCCAGATAGGAGGGATTCTTATGAATAACGCCCAAA
AAGCGAAGCTTTCAGGCGTGACGATCTCAACGGGAACAGAATGTCTTCTGGTAGCACCTTATTGCGAGGA
TGACATAGAAGAAAAAAGCACTACTGTGCAATAA