SecReT6
Protein ID: 389841826
SecReT6 ID663
T6SS typei3
Gene symbolimpG
Locus tagES15_2826
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3044323..3046203 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDI2EL47
KEGG IDcsk:ES15_2826
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-205, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|389841826|ref|YP_006343910.1| type VI secretion protein [Cronobacter sakazakii ES15]
MDNKFLDYYNKELTYMREMAQEFALQHPKIAARLGMHGIEIADPYVERLIEAFCFMSARVQIKLDAGFPQ
FTQRLLDIIYPNYTSPVPSMGVVQLKPDFKEGDLTHGYTVARHSAFYSPIAPGEATRCEFRNGHAVTLWP
LEITEARLTSLPPDIPSTAKFVLPVQRLKGALRIKLKLHENLRFSQLAGLEQLPVYIDGDERVVSHIFEL
IHTAHVAMMIHGKTSAGNVDTLVTEMPLTFEGLNPEQSLLPAQWNIFHGHTLLQEYFTCRQRFYFFTLTQ
LSEGLKKIDSNEAEIIILLDNAPQDLVAHITAARFLLFCTPVINLFPKQMDRIEINRALNEFHVVADRSR
PLDYEIFSISKVAGQQAESSNEVTFSPLFQTRHYPHGNAGRYFSHTRRPRTLDKNVRHYETRTSYRGTEV
FISLVDQHEAPFSDDLRYLSVDALVTNRDLPVLLSRSGHFDLTMTDAAPVESARFVCAPSFPHSPFAEGE
SAWRLIRQLSFNYQPLADMDHSTGGEALRKMLRLFISHSDHEASTQIDALVGCKSEPIVRRLPDDGLLIY
GRGVRCTLTVDEAGFSGISPYLFGLIMENYIARHAAINVFTETELVSMQRGRISRWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|389839000|ref|NC_017933.1|:3044323-3046203 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGATAATAAATTTCTTGATTATTACAATAAAGAACTCACTTACATGCGAGAAATGGCGCAGGAGTTTG
CATTGCAGCATCCAAAAATTGCTGCGCGCCTGGGTATGCATGGAATTGAAATTGCCGATCCTTACGTGGA
ACGTTTGATAGAAGCGTTTTGTTTTATGTCTGCCAGAGTCCAGATTAAACTGGACGCCGGCTTTCCGCAG
TTTACACAGCGCCTGTTAGATATTATTTATCCTAATTATACTTCTCCGGTTCCCTCTATGGGGGTAGTGC
AATTGAAGCCCGATTTCAAAGAGGGAGATTTAACTCACGGGTATACCGTTGCCCGTCACAGCGCTTTTTA
TTCCCCCATCGCACCGGGTGAGGCAACCCGCTGTGAATTCCGCAACGGTCACGCGGTCACGCTATGGCCA
CTGGAGATTACCGAGGCAAGGTTAACCTCTTTACCTCCTGACATTCCTTCGACAGCAAAATTCGTTCTGC
CTGTTCAGCGCCTTAAAGGCGCACTGCGTATCAAGCTAAAGCTGCATGAGAATTTACGTTTTTCGCAATT
AGCCGGGCTTGAACAACTGCCTGTTTATATTGATGGTGATGAGCGTGTCGTTTCGCACATTTTTGAGCTC
ATCCATACTGCGCATGTCGCTATGATGATTCACGGTAAGACGTCTGCCGGGAATGTCGACACGTTAGTCA
CAGAGATGCCGCTTACCTTTGAGGGGTTAAACCCCGAACAGTCCTTACTGCCTGCGCAGTGGAACATCTT
TCATGGGCATACGCTTCTTCAGGAATATTTTACCTGCCGCCAGCGCTTCTACTTTTTTACGCTCACACAA
CTGAGTGAAGGGCTAAAAAAGATAGACAGCAACGAAGCTGAAATCATTATCTTGCTTGATAACGCGCCTC
AGGATCTGGTAGCCCATATCACGGCTGCGCGCTTTCTGCTTTTTTGTACACCGGTGATAAATCTGTTTCC
CAAACAGATGGACAGAATCGAAATTAACCGGGCATTGAATGAGTTTCATGTTGTTGCCGATCGCAGTCGC
CCGCTGGATTACGAAATTTTTTCGATAAGTAAAGTGGCAGGACAGCAGGCTGAAAGCAGCAACGAAGTCA
CGTTCAGTCCTCTTTTCCAGACGCGTCATTACCCTCATGGGAATGCCGGACGTTATTTTTCACATACCCG
ACGCCCCAGAACGCTGGACAAAAACGTTCGTCATTATGAAACACGCACCTCGTATCGGGGCACCGAAGTG
TTTATCTCGTTGGTTGACCAGCATGAGGCGCCTTTTAGCGACGATCTTCGTTATTTATCGGTCGATGCGC
TGGTCACTAATCGCGATCTGCCCGTTTTGCTTTCTCGTTCTGGCCATTTTGATCTCACCATGACCGACGC
CGCACCGGTTGAAAGCGCACGATTTGTCTGCGCGCCCTCTTTTCCACACTCTCCTTTTGCAGAAGGCGAA
TCCGCCTGGCGACTGATACGACAGCTCAGTTTCAATTATCAGCCGCTGGCAGACATGGATCACAGCACGG
GTGGAGAAGCGCTACGCAAGATGCTGCGGTTGTTCATCAGCCATTCTGATCATGAGGCCAGTACCCAGAT
AGATGCCCTGGTGGGATGTAAAAGCGAGCCCATTGTCCGCCGCTTACCCGATGATGGTCTGCTTATTTAT
GGCAGAGGCGTGCGCTGTACCCTGACGGTAGACGAGGCAGGTTTCTCAGGCATTAGTCCGTATCTCTTCG
GTCTTATTATGGAAAATTACATCGCCCGACATGCTGCGATTAATGTGTTCACCGAAACAGAATTAGTCTC
CATGCAACGTGGACGCATCAGTCGCTGGAAAGCGCGCCCGGGAAGGCGAGGCGTTTTGTAA