SecReT6
Protein ID: 389841828
SecReT6 ID663
T6SS typei3
Gene symbolimpA1
Locus tagES15_2828
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]3047286..3048332 [+]
ProductImpA family protein
NoteTssA
UniProt IDI2EL49
KEGG IDcsk:ES15_2828
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.80E-20, Aligned region: 61..120
Protein Sequence: 348 a.a.     [Download]
>gi|389841828|ref|YP_006343912.1| ImpA family protein [Cronobacter sakazakii ES15]
MDLDTLQVSEYYQPLMMPLPGAFPCGVNLEYDSDFILLLSRLQPRLDAEYGQFIEAAEPVNWAEIERDCL
ALLNRSKDIRLLIILMRCRLRQTGLTALEEGLIALSFFLTHWPEDIHPQLYDEGEFDPLMRINALNELED
IHGIIGDLRNQLLPKVAGSQITLKIFEKSHALPRDSDALPETMLSALRLEWKTRNDPVMRSLQLAKAWLD
KIKNIIPQKTNIDMPDFPQMSQLLSLFLSEDEQSAVYCETPVASPQPGASGEESIVPVLMPDEVSAQVTM
TAQPHTINSRTEALSRLKEIRAWFIHAEPSSPVIPLLAFTERTIGMHFNELLKFIPAELISRLDTEKD
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|389839000|ref|NC_017933.1|:3047286-3048332 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGACTTAGATACTCTGCAGGTATCGGAATATTATCAACCACTCATGATGCCTCTCCCAGGTGCATTTC
CGTGCGGTGTAAACCTCGAATATGACTCCGATTTCATTTTACTACTGTCACGATTACAGCCGAGGCTTGA
TGCGGAATATGGCCAGTTTATCGAGGCCGCAGAACCCGTAAACTGGGCGGAAATTGAACGTGACTGTTTA
GCGCTACTCAACCGCAGTAAAGATATCAGATTGCTGATTATTCTTATGCGGTGCCGCTTGCGACAAACAG
GACTGACGGCGCTTGAGGAAGGGCTCATTGCGCTATCTTTTTTTCTAACACACTGGCCTGAAGATATTCA
TCCACAGCTTTATGACGAAGGGGAGTTCGATCCCCTGATGCGTATTAACGCGCTAAATGAGCTGGAAGAT
ATTCATGGCATCATTGGCGATTTGCGTAATCAATTGTTGCCCAAAGTCGCCGGTTCGCAGATCACACTTA
AAATATTCGAAAAATCGCATGCTCTCCCGCGCGACAGCGATGCATTGCCTGAAACAATGCTTTCCGCCTT
ACGTCTCGAATGGAAAACGCGGAATGATCCTGTAATGCGCTCCTTACAATTGGCAAAGGCATGGCTCGAT
AAGATAAAAAATATAATCCCGCAGAAAACCAATATCGATATGCCTGATTTTCCTCAAATGAGCCAGCTTT
TGAGCCTCTTTCTCTCAGAGGATGAACAGTCAGCGGTCTATTGCGAAACTCCGGTTGCTTCCCCTCAACC
GGGCGCGTCAGGAGAGGAGTCAATAGTGCCTGTGCTGATGCCAGACGAGGTATCTGCGCAAGTAACAATG
ACAGCGCAACCGCACACTATAAATAGTCGAACGGAGGCGCTTTCCCGGCTTAAAGAAATCCGCGCCTGGT
TTATTCATGCCGAGCCAAGTAGCCCCGTCATACCGCTACTGGCTTTTACCGAGCGGACCATCGGAATGCA
TTTTAACGAGTTATTAAAGTTTATCCCGGCGGAGTTAATTTCCCGACTGGATACAGAAAAGGATTAA