SecReT6
Protein ID: 389842806
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3806
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4152686..4157218 [-]
Producthypothetical protein
NotePAAR
UniProt IDI2ENX7
KEGG IDcsk:ES15_3806
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 479..541
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 527..552
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 628..660
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 650..681
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 698..724
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 730..745
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 751..788
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 795..820
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 836..869
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 877..908
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 921..940
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 982..1016
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1048..1077
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1067..1107
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1123..1152
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1143..1186
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1172..1199
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1193..1225
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1293..1308
RHS_repeat [PF05593], Evalue: 8.90E-61, Aligned region: 1354..1378
DNase_NucA_NucB [PF14040], Evalue: 7.60E-27, Aligned region: 1410..1509
RHS [PF03527], Evalue: 6.70E-13, Aligned region: 661..674
RHS [PF03527], Evalue: 6.70E-13, Aligned region: 773..788
RHS [PF03527], Evalue: 6.70E-13, Aligned region: 872..886
RHS [PF03527], Evalue: 6.70E-13, Aligned region: 1285..1322
PAAR_motif [PF05488], Evalue: 2.50E-10, Aligned region: 89..116
PAAR_motif [PF05488], Evalue: 2.50E-10, Aligned region: 197..244
DUF4150 [PF13665], Evalue: 0.0012, Aligned region: 94..122
DUF4150 [PF13665], Evalue: 0.0012, Aligned region: 209..241
Protein Sequence: 1510 a.a.     [Download]
>gi|389842806|ref|YP_006344890.1| hypothetical protein ES15_3806 [Cronobacter sakazakii ES15]
MSELLAARIDDPLIHSSLLADVVSGAVEGAICLAAITAGSAMMGTGLGTVAGVVLIAAVFTTGVAEDAGD
LVGQGVDAVLDFFGWLGPPDAIIKTGSHNVRIMEKAAARAAGTVDHNYLNTPIPQESFGDQAKAFAIGTA
VAILEVAQFTLHPLDNLAAGASAIASSGWDGVKKFAGSVWDNFTQPVVAGASPYAKAAPGDIVVCTKGHT
VTGTNYLAEGSKKVLINGQPASRNGDRSTCEAKVKVKENTRVRIGGESIVVRDIRSGKNFWARLIGNTIG
SLGPAIIRNLSKGMLKTLFSRQIMKTFCCQFAADLGMGLTTFGLIQAGKVGSEARQTQHPVDIASGAKIL
AGAEDRDFTLEDRIPLIWQRVYNSRNLATGMLGTGWLLPFETRFFRLENNQFIWRDMSGRELGFGELTPG
DVVDYLEDGVTLYYTVSGTLMLQMTSGEYHVYEPDPTRPGEWRLFRIYDRHENCQYYSWDEHGRLVRISG
DNEALDVELAYEKTHGRLASVHQVCNGERRLLVTYGYNEHGQLTDVTDADGIVTRRFGWDRASDMMGWHS
YSTNLSVHYQWQPAADAPNWRVCGYQVLDDQDNVLERWRIDADEAKRCATVSCDAGFSTRHCWDFLYRIT
EYTDRHGGVWRYEWADYAELLTAATTPDGSRWVYGHDEHGNLTEVRDPLGNSTFTTWHPVFAFPVKEVLP
DGATWQYEYNPRGDVVALTDPKGGVTRFEWNEQGDLVQQTDALNNTHRFWWNERGQLVRDEDCSGNQSQR
LYDAAGRPLSASDAEGNTDRWTLTAAGRLRTWRRADGRETHYEYDSAGLLCGQDDDGLRERKVTRNARGQ
VVSAADPAGHQTRLRYDRFGRLRTLVNPNRESWRFEYDAAGRLTGQRDYAGRLTEYRHDALGQVTEVIRH
PLPGSADAPLVTAFEYDVLGRLTARETAEHRTEYRHNTLSLEIRRATRAEWRQALLEEREPAWDAVLIFT
RNAAGELVSEENHGGKFEYEYDALGNLSSTTFPDGRELATLRYGTGHLLEMQLRHGGAMHTLAAYGRDRL
HREISRSQGVLSQETRYDAAGRVTQRTVLDARRELEFERRYRWDRTDQIVQQIHTDATPATPGEKYSQYL
WGYDAAGQVTKAVEPQKEERFFWDPAGNRTEEHRNPVWHNLLLRLDGLKLDYDGFGRLIQRRDKSGLIQH
FAYDDEQRVKEIRFEGNSEFRKVEYRYDPLGRRTHKVLWRYNDPQPETIRFDWQGLQLAGEQSDREPDHC
VQYVYTEGSYEPLARVDSVFDDCEIYWYHTGLNGLPERVTDADGQTVWRGQFSTWGETERELSVPQWQVP
QNLRFQGQYLDRESGLHYNLFRYYDPVAGRYTQMDPIGLAGGINTYSYVGDPLTWVDPLGWKGCLVLEGD
GTTHDIVLVLTKKEYKQTFGHIEDVINERNKDIYTISRSSAHMNRNESLKGYPTKEGFDRDEFPMAMFKE
GGKGASVRYIDPSDNRGAGSSIANALKPFPDGTKVKIKVE
 
Nucleotide Sequence: 4533 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4157218-4152686 Cronobacter sakazakii ES15 chromosome, complete genome
GTGTCCGAACTGTTAGCTGCCCGTATAGATGATCCGCTCATCCACAGCTCTCTGCTCGCCGATGTCGTCA
GTGGCGCGGTGGAGGGGGCTATCTGTCTTGCCGCCATAACGGCGGGTTCGGCGATGATGGGCACGGGGCT
GGGTACGGTTGCGGGCGTTGTACTGATTGCGGCCGTATTCACCACGGGTGTTGCAGAGGACGCCGGCGAT
CTGGTGGGGCAAGGCGTCGATGCTGTGCTGGATTTCTTCGGCTGGCTCGGCCCGCCGGATGCGATTATCA
AGACAGGCTCTCACAACGTACGCATTATGGAAAAAGCCGCCGCGCGCGCGGCGGGCACGGTTGATCACAA
CTATCTCAATACGCCCATTCCGCAAGAGAGCTTTGGCGATCAGGCGAAGGCATTTGCGATAGGCACCGCG
GTTGCCATTCTCGAAGTGGCGCAGTTTACCCTGCACCCGCTGGATAACCTGGCGGCAGGAGCAAGCGCCA
TCGCCAGCAGCGGCTGGGACGGAGTAAAAAAATTCGCGGGCAGCGTCTGGGATAACTTCACGCAACCCGT
CGTGGCGGGTGCCAGTCCGTACGCTAAGGCGGCGCCGGGCGATATCGTGGTGTGCACCAAAGGCCATACG
GTGACCGGCACCAACTACCTGGCGGAAGGCTCGAAAAAAGTGCTGATCAATGGCCAGCCCGCGAGCCGCA
ACGGCGATCGCAGCACCTGCGAAGCCAAAGTCAAAGTTAAAGAAAACACGCGTGTGCGCATCGGCGGCGA
AAGCATCGTGGTGCGCGATATCCGCAGCGGTAAGAATTTCTGGGCGCGGCTTATTGGCAACACCATCGGC
AGCCTTGGCCCGGCGATTATCCGCAACCTCAGCAAAGGGATGCTGAAGACACTCTTCAGCCGCCAGATCA
TGAAAACCTTTTGCTGCCAGTTTGCCGCCGATCTCGGCATGGGCCTGACGACATTCGGGCTGATTCAGGC
AGGCAAAGTGGGCAGTGAGGCGCGCCAGACGCAGCACCCGGTGGATATCGCCAGCGGCGCGAAAATTCTC
GCGGGCGCTGAAGACCGCGATTTCACGCTGGAAGATCGCATTCCGCTCATCTGGCAGCGTGTCTACAACA
GCCGCAATCTGGCGACCGGTATGCTCGGCACCGGCTGGCTCCTGCCGTTTGAGACCCGCTTCTTCCGCCT
TGAGAACAATCAGTTTATCTGGCGCGATATGTCGGGCCGCGAGCTGGGCTTCGGCGAGCTGACCCCCGGC
GACGTGGTGGATTATCTCGAAGACGGCGTCACGCTCTATTACACCGTCAGCGGCACACTGATGCTTCAGA
TGACGAGCGGCGAGTACCACGTCTACGAACCGGACCCGACGCGTCCGGGCGAGTGGCGGCTGTTCCGCAT
CTACGATCGTCACGAGAACTGCCAGTACTACAGCTGGGATGAACACGGCAGGCTGGTGCGGATTTCCGGC
GACAACGAAGCGCTGGATGTCGAACTCGCGTATGAGAAAACGCATGGCCGCCTCGCCAGCGTGCACCAGG
TATGCAACGGCGAGCGCCGCCTGCTGGTGACTTACGGTTATAACGAACACGGCCAGTTGACTGACGTGAC
CGACGCGGACGGCATCGTCACGCGCCGCTTCGGCTGGGATCGCGCCAGCGACATGATGGGCTGGCACAGC
TACTCCACCAACCTCAGCGTGCATTATCAGTGGCAGCCCGCCGCCGATGCGCCGAACTGGCGCGTGTGCG
GTTATCAGGTGCTGGACGACCAGGACAACGTGCTGGAGCGCTGGCGCATCGACGCCGACGAGGCGAAACG
CTGCGCCACGGTAAGCTGCGACGCGGGTTTCTCGACGCGCCACTGCTGGGATTTCCTCTATCGCATCACG
GAATACACCGACCGCCACGGCGGCGTGTGGCGCTACGAGTGGGCGGATTATGCCGAGCTGCTGACCGCGG
CCACCACGCCGGACGGCAGCCGCTGGGTATACGGCCACGACGAGCACGGCAACCTGACGGAAGTGCGCGA
CCCGCTCGGCAACAGCACGTTCACCACGTGGCACCCGGTGTTCGCGTTCCCGGTGAAAGAGGTGCTGCCG
GACGGCGCCACCTGGCAGTATGAATACAACCCGCGCGGCGATGTGGTGGCGCTCACCGACCCGAAAGGCG
GCGTGACGCGCTTTGAGTGGAACGAGCAGGGCGACCTGGTTCAGCAGACCGACGCGCTGAACAACACGCA
CCGGTTCTGGTGGAACGAGCGCGGGCAGCTGGTGCGCGACGAGGACTGCTCCGGCAACCAGAGCCAGCGG
CTTTATGACGCGGCAGGTCGACCGCTGAGCGCCAGCGACGCCGAAGGCAACACCGACCGCTGGACGCTGA
CTGCGGCAGGGCGTCTGCGCACCTGGCGGCGGGCGGACGGCCGCGAGACGCACTACGAATATGACAGCGC
CGGGCTGCTCTGCGGGCAGGACGATGACGGGCTGCGCGAGCGCAAGGTGACGCGCAACGCGCGCGGGCAG
GTGGTGAGCGCCGCCGACCCGGCGGGCCACCAGACGCGCCTGCGTTACGACCGCTTCGGCCGCCTGAGGA
CGCTGGTGAACCCGAACCGCGAGAGCTGGCGGTTTGAGTATGACGCCGCAGGCCGCCTGACGGGCCAGCG
GGATTACGCGGGCCGCCTGACGGAATACCGCCACGACGCGCTGGGCCAGGTGACGGAGGTGATCCGCCAT
CCGCTGCCGGGCAGCGCGGACGCGCCGCTGGTCACGGCGTTTGAATATGACGTGCTGGGGCGTCTCACTG
CCCGCGAAACCGCAGAGCACCGCACCGAATACCGCCACAACACGCTGTCGCTGGAAATCCGCCGCGCCAC
GCGCGCTGAATGGCGGCAGGCGCTGCTGGAAGAGCGGGAGCCTGCGTGGGACGCCGTACTCATCTTCACC
CGCAACGCCGCGGGCGAGCTGGTGAGCGAGGAGAACCACGGCGGGAAGTTTGAGTATGAGTACGACGCGC
TGGGTAATCTCAGCAGCACAACGTTCCCTGATGGCCGGGAGCTTGCCACGCTGCGCTACGGCACCGGCCA
CCTGCTGGAGATGCAGCTGCGCCACGGCGGGGCCATGCACACGCTGGCGGCGTACGGCCGCGACCGCCTG
CACCGGGAAATCTCGCGCAGCCAGGGCGTGCTCTCGCAGGAAACCCGCTACGACGCCGCAGGGCGCGTCA
CGCAGCGTACGGTGCTGGACGCCCGCCGTGAACTGGAGTTTGAGCGCCGCTACCGGTGGGACCGCACCGA
CCAGATAGTCCAGCAGATACACACCGATGCGACTCCTGCAACACCGGGCGAGAAATACAGCCAGTACCTG
TGGGGCTACGATGCCGCCGGTCAGGTCACGAAAGCCGTTGAACCGCAGAAAGAAGAACGCTTTTTCTGGG
ACCCGGCAGGCAACCGCACTGAGGAGCACCGCAACCCGGTGTGGCACAACCTGCTGCTGCGCCTCGACGG
GCTGAAGCTGGACTATGACGGGTTCGGGCGGCTGATTCAGCGGCGGGATAAATCCGGCCTTATCCAGCAT
TTTGCCTATGACGACGAGCAGCGGGTAAAAGAGATTCGGTTTGAGGGGAACAGCGAATTCAGAAAGGTTG
AATACCGCTATGACCCGCTGGGCCGCAGGACGCATAAGGTTCTGTGGCGTTATAACGACCCGCAGCCGGA
AACTATCCGCTTCGACTGGCAGGGCCTGCAACTGGCGGGTGAACAGAGCGACCGCGAGCCGGACCACTGC
GTTCAGTACGTTTACACCGAGGGCAGCTATGAGCCGCTGGCGCGCGTCGACAGTGTTTTCGACGACTGTG
AGATTTACTGGTATCACACCGGACTCAACGGCCTGCCGGAGCGGGTGACGGACGCGGACGGCCAGACGGT
CTGGCGCGGGCAGTTCAGCACCTGGGGCGAAACCGAACGCGAACTCAGCGTGCCGCAGTGGCAGGTGCCA
CAGAACCTGCGCTTCCAGGGCCAGTACCTCGACCGGGAAAGCGGGCTGCACTACAACCTGTTCCGCTACT
ACGACCCGGTGGCCGGGCGTTACACCCAGATGGACCCGATTGGGTTAGCGGGCGGGATTAATACCTACAG
CTATGTGGGTGATCCGCTGACGTGGGTGGACCCGTTGGGGTGGAAAGGTTGCCTTGTTCTTGAAGGTGAT
GGAACGACTCATGACATTGTCCTGGTTTTAACTAAAAAAGAATATAAGCAAACATTTGGACATATTGAGG
ATGTTATTAATGAAAGAAACAAAGATATTTATACGATAAGCCGTTCATCAGCACATATGAATAGAAACGA
GTCTCTTAAAGGCTATCCAACTAAAGAAGGTTTTGACAGAGATGAATTCCCTATGGCTATGTTCAAAGAA
GGCGGTAAAGGTGCAAGCGTAAGATACATTGATCCTAGTGATAATCGTGGGGCTGGATCTTCAATAGCAA
ATGCACTTAAACCGTTCCCGGATGGAACTAAAGTTAAAATTAAAGTTGAATAA