SecReT6
Protein ID: 389842822
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3822
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4169743..4171995 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI2ENZ3
KEGG IDcsk:ES15_3822
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.70E-74, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 4.70E-74, Aligned region: 528..558
Phage_base_V [PF04717], Evalue: 5.50E-24, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 0.0024, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 0.0024, Aligned region: 579..596
Gp5_C [PF06715], Evalue: 0.0024, Aligned region: 602..616
Gp5_C [PF06715], Evalue: 0.0024, Aligned region: 632..647
Protein Sequence: 750 a.a.     [Download]
>gi|389842822|ref|YP_006344906.1| Rhs element Vgr protein [Cronobacter sakazakii ES15]
MLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYLNGK
VTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSYRVW
EYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLVLTDAPGQYEPFPGYETIPYHVTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQ
VEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGPDSNTLHEIRFEVIPADV
PYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPDDATRMGFMTRSKDGHRDNASYLFFEDKMG
DELLDMHAEKNMNISVENDKTVTIDGSRTTTIGREQKDEVTGDASFYYKQKRTTVVDNVELKDFNNSEII
NIKEGRKLTISSGGELNNITGSQTTTIEKGNQHTTIKDGKQETIISTGGRNTEIKNGDRLIVSSGGQHNE
IKGGVKTVIDGGWTQTIKTGETLITSPNKITIKSSASVEIEAPFLSSDVKGTQMSITGLSGGITGMSFGL
TGVAVSHNIVDRSSKNIDLSDAEVKARFKNKIEIAKSGIKTYLNNLFIIG
 
Nucleotide Sequence: 2253 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4171995-4169743 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGGCGCGAGG
CGCTGTCGGAGCCGTTTATGTTCACCCTGACGCTGCTCGGCACCGACGCGCGGGCCGACCGCAGCGCGCT
GCTGGGCCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTCAACGGCAAG
GTGACCCGCGTGGCGGTGAGCGCGGTGGAGCTCTCCGGCACCCGCTACGCCGCCTACGAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGCAGCGCGACCGCAACCTGCGTATCTTCCAGGGCCAGACGGTGCCGCAGAT
AGTGAAAACGCTGCTGGGCGAGAGCCGGGTGAACATGGAAGAGCGGCTGTCGGGCAGCTACCGCGTCTGG
GAATACTGCGTGCAGTACCAGGAGAGCAGTCTGGACTTTATCAGCCGTCTGCTGGAGCTGGAGGGCATCG
CCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTGGTGCTGACGGATGCACCGGGCCAGTACGAGCC
GTTCCCCGGCTACGAGACCATTCCGTACCACGTCACGCCGTCCGGTGGCTCAACCGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAAGACAGCGTGACGCCGGGCATCTACAGTCTCGACGACTACGACTTCCGCAAGC
CCAACGCCTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGCATTGATGTTTACGA
CTGGCCGGGCCGTTTTGTGGAGCACGGGCATGGCGAGTTCTACGCCCGCATCCGCCAGGAGCGCTGGCAG
GTGGAGCACCGCCAGACCCAGGGCACCGCGACGGCGCTCGGCATCGCGCCCGGCCACACCTTTGTGCTGC
GTAACGCCCCGTTCTTCGGCGATAACGGCGAGTACCTCACCACGGTGGCGCATTACCGCTTTGAAGAGAA
CCGCTACGCCAGCGGCCCGGACAGCAACACCCTGCACGAAATCCGCTTTGAGGTGATACCGGCGGACGTG
CCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGGTGGTCGGCC
CGCAGGGTGAGAGCATCTGGACGGATAAATATGGCCGCGTGAAGGTGAAGTTCCACTGGGACCGTCTGGG
CAAGGGTGACGACACCAGTTCCAGCTGGGTGCGTGTCTCCAGCGCGTGGGCAGGCCAGGGCTTCGGCGGG
GTGCAGATACCGCGCGTGGGCGATGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TTACCGGCCGCGTGTACAACGAAGCCAGCATGCCGCCGTGGGCGCTGCCGGATGATGCCACGCGCATGGG
CTTTATGACCCGCAGTAAAGACGGGCATCGCGATAACGCCAGCTATCTGTTTTTTGAAGATAAGATGGGC
GATGAGTTGCTGGATATGCATGCCGAGAAAAACATGAATATCTCGGTAGAAAACGACAAGACAGTCACGA
TTGATGGCAGCCGCACCACGACTATCGGACGTGAGCAAAAAGATGAAGTGACGGGCGATGCATCTTTCTA
CTATAAGCAGAAGCGCACGACGGTAGTCGATAATGTTGAGCTCAAAGATTTTAATAATAGCGAAATTATT
AATATCAAAGAAGGTCGCAAACTTACCATCTCCAGTGGCGGTGAGTTAAATAACATTACCGGGAGTCAGA
CAACGACCATTGAAAAAGGTAACCAACACACTACGATCAAGGATGGAAAACAAGAAACCATTATTAGTAC
TGGCGGGCGTAATACAGAAATTAAAAATGGTGATCGTTTAATAGTCAGTAGTGGTGGTCAACATAATGAA
ATAAAAGGTGGCGTAAAAACAGTCATTGATGGTGGTTGGACGCAGACTATAAAAACTGGTGAAACTTTGA
TTACATCGCCTAATAAAATAACAATAAAGAGTAGTGCTAGTGTTGAAATAGAAGCTCCGTTTTTGTCAAG
CGATGTAAAAGGCACGCAAATGTCTATTACGGGATTGTCGGGCGGAATAACAGGCATGTCATTTGGATTA
ACTGGCGTTGCCGTATCTCATAATATCGTTGACAGGTCTTCAAAAAACATTGATTTAAGCGATGCAGAAG
TCAAAGCTCGGTTTAAGAATAAAATCGAAATTGCAAAGTCTGGTATTAAAACTTATCTTAATAATCTTTT
TATTATAGGGTGA