SecReT6
Protein ID: 389842825
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3825
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4173870..4174964 [-]
Producthypothetical protein
NotePAAR
UniProt IDI2ENZ6
KEGG IDcsk:ES15_3825
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 11..75
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 238..248
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 348..362
DUF4150 [PF13665], Evalue: 1.20E-06, Aligned region: 20..39
DUF4150 [PF13665], Evalue: 1.20E-06, Aligned region: 46..79
DUF4150 [PF13665], Evalue: 1.20E-06, Aligned region: 171..189
DUF4150 [PF13665], Evalue: 1.20E-06, Aligned region: 279..298
DUF4150 [PF13665], Evalue: 1.20E-06, Aligned region: 333..363
Protein Sequence: 364 a.a.     [Download]
>gi|389842825|ref|YP_006344909.1| hypothetical protein ES15_3825 [Cronobacter sakazakii ES15]
MGKPAARALIDKGAHLGLIQTGSPNVIIGGFPAARKTDGLLCKKHGQGIIVGGSGTVFVNGLPLARLGDQ
TQCNKAAAPKDKTAPPKYWGATVAKKAGPDGVIHGDNYDARALGAYASLEDKSGTGRFDTATIGFALQDL
VIGNMKSQSLIRGEMRTKVAAANASGTLYVTEKDMATGSANATATGVQYGATGAIGKEGGLYMSAGGDFT
FGTAEAKVISEVYRGGKGKYGFSTEIGAEAAAVKGEITTKSDILGVLTTEGKIGGSLGSVGASAGMALLV
DETDYSLNVKASGELALALGIKGDVNIKFALKPLYDKWIDFHIHLIKLGAEFIYGDQKNKNVATKSVSGD
GIIISGCGTVLVGD
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4174964-4173870 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGGGAAGCCAGCCGCCAGAGCGCTAATTGATAAAGGCGCGCATTTGGGTTTAATACAGACAGGGAGTC
CAAATGTAATTATTGGTGGATTTCCTGCAGCAAGAAAGACTGACGGTTTATTGTGCAAAAAACACGGCCA
GGGAATAATAGTCGGTGGTTCTGGCACGGTGTTTGTTAATGGGCTTCCTCTTGCCCGGTTGGGAGATCAG
ACCCAGTGTAATAAAGCTGCGGCTCCTAAAGACAAAACCGCCCCACCAAAATATTGGGGAGCAACGGTAG
CAAAAAAAGCAGGGCCAGATGGCGTTATTCATGGTGATAACTATGATGCGCGAGCACTGGGGGCGTATGC
CAGCCTGGAGGATAAGTCTGGAACAGGCAGGTTCGACACGGCAACAATTGGCTTTGCTTTACAAGACTTA
GTGATAGGTAATATGAAAAGCCAGTCGTTAATCCGTGGCGAAATGCGCACCAAAGTAGCAGCCGCCAATG
CTTCAGGAACCCTTTATGTTACTGAAAAAGATATGGCAACCGGCAGTGCCAATGCTACCGCTACTGGTGT
TCAGTATGGTGCTACAGGTGCAATTGGTAAAGAAGGCGGTCTGTATATGAGCGCAGGCGGCGATTTTACG
TTCGGCACAGCTGAAGCTAAAGTGATCAGTGAAGTTTATCGTGGTGGTAAAGGGAAATATGGTTTTTCAA
CTGAGATTGGTGCTGAGGCAGCGGCCGTCAAAGGAGAGATTACAACTAAAAGCGACATCCTCGGAGTGCT
GACAACAGAAGGTAAGATTGGCGGGTCCTTAGGGAGTGTAGGCGCGTCTGCAGGAATGGCGTTGTTGGTT
GATGAAACCGATTACTCTTTGAATGTAAAGGCCTCTGGTGAGCTTGCGCTTGCGTTAGGTATCAAAGGGG
ATGTAAATATCAAATTCGCCCTAAAGCCGCTATATGATAAATGGATTGACTTTCACATTCATTTAATTAA
GCTTGGGGCTGAGTTTATTTATGGTGATCAGAAAAATAAAAACGTCGCTACTAAATCTGTGTCGGGGGAT
GGAATAATAATTAGTGGTTGCGGAACGGTCTTGGTTGGAGACTAA