SecReT6
Protein ID: 389842826
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3826
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4174987..4176948 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDI2ENZ7
KEGG IDcsk:ES15_3826
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-74, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 4.40E-24, Aligned region: 365..458
Protein Sequence: 653 a.a.     [Download]
>gi|389842826|ref|YP_006344910.1| type VI secretion system effector protein VgrG [Cronobacter sakazakii ES15]
MLNRITVQLPVEGLLFWKLSGREALSEPFMFTLTLLGTDARADRSALLGQPVTVTIPTQALMTPRYLNGK
VTRVAVSAVELSGTRYAAYELTVEPDLWPMQRDRNLRIFQGQTVPQIVKTLLGESRVNMEERLSGSYRVW
EYCVQYQESSLDFISRLLELEGIAYHFRHEQDRHTLVLTDAPGQYEPFPGYETIPYHVTPSGGSTDEEGI
SQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPLSPQPGSIDVYDWPGRFVEHGHGEFYARIRQERWQ
VEHRQTQGTATALGIAPGHTFVLRNAPFFGDNGEYLTTVAHYRFEENRYASGPDSNTLHEIRFEVIPADV
PYRPAQKTPWPRTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLGKGDDTSSSWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLITGRVYNEASMPPWALPAAATQMGFLSRSKNGHKDNANALRFEDKAG
HEQIWIHAERNMDTEIENSETHHVAVDRNKTIGRDEKNTIKRNVTTSVGVDSINSIGSKHTVNVGQSACI
LTMDKDGNTSLEATSSIKLKVGDNYLLITPTGINITVLQGDLTAESINSASLKGDQLTAIGGGVNVDTTA
KNTVNITGVNLTDIKGAVVKINS
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4176948-4174987 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCTCAACCGAATCACCGTTCAGCTCCCGGTCGAGGGGCTGCTTTTCTGGAAACTCTCCGGGCGCGAGG
CGCTGTCGGAGCCGTTTATGTTCACCCTGACGCTGCTCGGCACCGACGCGCGGGCCGACCGCAGCGCGCT
GCTGGGCCAGCCGGTGACGGTGACCATCCCGACCCAGGCGCTGATGACGCCGCGCTACCTCAACGGCAAG
GTGACCCGTGTGGCAGTGAGCGCGGTGGAGCTCTCCGGCACCCGGTACGCGGCCTATGAGCTGACGGTGG
AGCCGGACCTGTGGCCGATGCAGCGCGACCGCAACCTGCGTATCTTCCAGGGGCAGACGGTGCCGCAGAT
AGTGAAAACCCTGCTCGGCGAGAGCCGGGTGAATATGGAAGAGCGTCTTTCCGGCAGCTACCGCGTCTGG
GAATACTGCGTGCAGTACCAGGAGAGCAGCCTCGATTTCATCAGCCGCCTGCTGGAGCTGGAGGGTATTG
CCTACCACTTCCGCCACGAGCAGGACCGCCACACGCTGGTGCTGACGGACGCGCCGGGCCAGTACGAGCC
GTTCCCCGGCTACGAAACCATTCCGTACCACGTCACGCCGTCCGGTGGCAGCACAGACGAAGAGGGCATC
AGCCAGTGGGCGCTGGAAGACAGCGTGACGCCGGGCATCTACAGCCTCGACGACTACGACTTCCGCAAGC
CCAACGCGTGGCTGTTCCAGGCGCGGCAGAACCCGCTGTCGCCGCAGCCGGGGAGCATTGACGTTTACGA
CTGGCCGGGCCGTTTTGTGGAGCACGGTCACGGCGAGTTCTACGCCCGCATCCGCCAGGAGCGCTGGCAG
GTTGAGCACCGCCAGACCCAGGGCACCGCGACGGCGCTCGGCATCGCGCCCGGCCACACCTTTGTGCTGC
GTAACGCCCCGTTCTTCGGCGATAACGGCGAGTACCTCACCACGGTGGCGCATTACCGCTTTGAAGAGAA
CCGCTACGCCAGCGGCCCGGACAGCAACACCCTGCACGAAATCCGCTTTGAGGTGATACCGGCGGACGTG
CCGTACCGCCCGGCGCAGAAGACGCCGTGGCCGCGCACCTACGGCCCGCAGACGGCGAAGGTGGTCGGCC
CGCAGGGTGAGAGCATCTGGACGGATAAATATGGCCGCGTGAAGGTGAAGTTCCACTGGGACCGTCTGGG
CAAGGGCGACGACACCAGTTCCAGCTGGGTGCGTGTCTCCAGCGCGTGGGCAGGCCAGGGCTTCGGCGGG
GTGCAGATACCGCGCGTGGGCGACGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGTCCGCTGA
TTACCGGGCGCGTGTATAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCGGCTGCAGCGACACAGATGGG
CTTTTTAAGCCGTAGTAAAAATGGTCATAAAGATAACGCCAACGCCCTGCGCTTTGAGGATAAGGCGGGC
CATGAGCAGATCTGGATCCATGCAGAAAGAAATATGGATACAGAAATTGAAAACTCTGAGACCCATCACG
TTGCTGTAGATCGTAATAAAACAATAGGTAGAGATGAAAAAAATACCATTAAAAGAAATGTGACTACCAG
CGTGGGTGTTGACTCAATTAATAGTATTGGTTCGAAGCATACTGTCAACGTTGGTCAGTCTGCCTGTATA
TTAACTATGGATAAAGACGGTAATACATCTCTGGAAGCAACATCAAGCATTAAACTCAAAGTAGGTGATA
ATTATTTATTAATCACACCGACGGGTATAAATATTACTGTGTTGCAAGGAGATTTGACTGCCGAAAGCAT
AAATTCGGCCTCTTTAAAAGGCGATCAATTGACTGCAATAGGTGGTGGGGTAAATGTCGATACAACAGCA
AAAAATACCGTAAATATAACTGGGGTCAATCTTACTGATATCAAAGGTGCCGTAGTAAAAATAAATAGTT
AA