SecReT6
Protein ID: 389842832
SecReT6 ID664
T6SS typei3
Gene symbolimpH2
Locus tagES15_3832
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4183918..4184961 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDI2EP03
KEGG IDcsk:ES15_3832
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-108, Aligned region: 27..331
Protein Sequence: 347 a.a.     [Download]
>gi|389842832|ref|YP_006344916.1| type VI secretion system protein ImpH [Cronobacter sakazakii ES15]
MSETQPQPAPVKSVSRLPENYWQQMMAAPWRYDLFQMLRRLDAQGGERYRLGRAPLPRFEPLRIGQQPSM
AFAPSTLAAVKPRDNTPLYDVSILSFGLFGPNGPLPMHLTEYARERLYHHQDDSLSAFADLFHHRLTLLF
YRAWADAQPTASLDRTDGPRIEKYLASLIGMGQPGQMEKGSLSHHARYSLVGHLTRNGRDAEGLEKILRH
YFHVPVTIVQNIPQWMPLTEREKARLGAGRRMPRLGEAAFLGVAVRDVQHKFRIELGPLDEETYQRFLPG
EPWVEELRDWVRQYMGIEYEWEVRVILRADAVKGVTPGGTGRLGYSAWLGKQPTPQPRGDLVFRAES
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4184961-4183918 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAGTGAGACGCAGCCACAACCCGCGCCGGTAAAAAGCGTCTCCCGGCTGCCGGAGAATTACTGGCAAC
AGATGATGGCCGCGCCGTGGCGCTACGATCTGTTCCAGATGCTGCGCCGTCTCGACGCGCAGGGCGGCGA
GCGCTACCGTTTAGGCCGCGCGCCGCTGCCGCGCTTTGAGCCGCTGCGCATCGGCCAGCAGCCGTCGATG
GCCTTCGCGCCGTCAACGCTCGCCGCGGTGAAACCGCGCGACAATACGCCGCTGTACGATGTGTCGATTT
TAAGCTTCGGCCTGTTTGGCCCGAACGGCCCGCTGCCGATGCACCTGACCGAATATGCGCGCGAGCGTTT
GTATCATCATCAGGACGACAGCCTGAGCGCGTTCGCGGATCTGTTTCATCACCGCCTGACGCTGCTGTTC
TACCGCGCCTGGGCCGACGCCCAGCCGACCGCGTCGCTCGACCGCACTGACGGGCCGCGCATTGAAAAAT
ATCTCGCCTCGCTTATCGGCATGGGCCAGCCGGGGCAGATGGAAAAGGGCAGCCTGAGCCACCACGCGCG
CTATTCGCTGGTCGGCCATCTGACGCGCAACGGGCGCGACGCCGAGGGGCTTGAAAAAATTCTGCGCCAC
TATTTCCACGTGCCGGTGACGATTGTGCAGAACATCCCACAGTGGATGCCGTTAACCGAGCGTGAAAAAG
CGCGTCTCGGCGCGGGCCGCCGGATGCCGCGCCTCGGCGAGGCAGCGTTTCTCGGCGTGGCGGTGCGCGA
TGTGCAGCATAAATTTCGCATTGAACTCGGCCCGCTGGATGAAGAGACCTACCAGCGTTTTCTGCCCGGC
GAGCCGTGGGTCGAGGAGCTGCGCGACTGGGTGCGTCAGTATATGGGCATCGAGTATGAGTGGGAGGTGC
GCGTTATCCTGCGCGCCGACGCGGTAAAAGGCGTCACGCCTGGCGGCACGGGCCGCCTCGGCTACAGCGC
CTGGCTTGGCAAGCAGCCCACCCCGCAACCGCGCGGCGATCTGGTTTTTCGCGCGGAAAGTTAA