SecReT6
Protein ID: 389842833
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3833
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4184958..4186829 [-]
Producthypothetical protein
NoteTssF
UniProt IDI2EP04
KEGG IDcsk:ES15_3833
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-208, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|389842833|ref|YP_006344917.1| hypothetical protein ES15_3833 [Cronobacter sakazakii ES15]
MDSKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMLAPNYLAPTPSMAIAELHPDSAKGDLSNGFVVPRGTMMDSQLLKKNGVTCSYATAHDVRLLP
LHISQVELGGVPADAPLSQLGLSQRGAVSALRVRIACDGPVLLNHLDFDRLDFFLSGPDIQALQLLELLM
EHRVGIFCQTVGPKPSRVVLADDALRQEGFEADQALLPDDLRNFDGYRLLQEYFAFPARFQFLSLRGIGK
LLAQSGQANAFDIIILLDKTDTPLERVVDKSHLAMHCTPVINLFPKIAERQKLTEGLSEYHLVVDNIRPL
DYEIFSVSKIYASEDGQRDDQIFRPFWSTWSRDGGNYGAYFSLRREQRALSEHALRYGTRTGYVGSEAFV
SLVDASHAPWRDELRYITAEVMCTSRDLPLMLAQDMGQFVLPDSMPVRALTMRKGPTPPRPALAEGFSTW
RLISQLQMNYLSLMDAEDGEGAAALRQLLGLYARLAEAPVARQIDGIRHCVLEPVHRRVPEPGPIVFARG
VGISMTVDEQAFSGSSPWLLGSVLERVFARLVSMNSFTEFTLKSQQRGEVGYWGPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4186829-4184958 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGACAGTAAACTGCTCGAATATTACAACCGAGAGCTGGCGTATCTGCGCGAAATGGGCGCGGAGTTCG
CCGAACGCTACCCGAAAGTGGCGGGCAGGCTCGGTATGCGCGGGATTGAAGTCGCTGACCCGTACATCGA
GCGCCTGATGGAAGGCTTCGCCTTTCTCACCTCCCGCGTACAGCTCAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGCTCGCGCCGAATTATCTGGCCCCCACGCCGTCAATGGCGATAGCCG
AACTGCACCCGGACAGCGCCAAAGGGGATCTGAGCAACGGGTTTGTGGTGCCGCGCGGCACGATGATGGA
CAGCCAGCTTCTGAAAAAGAACGGCGTCACCTGTAGCTACGCCACCGCCCATGACGTGCGCCTGCTGCCG
CTGCATATCAGCCAGGTGGAGTTAGGCGGCGTGCCGGCCGATGCGCCGTTAAGCCAGCTCGGTTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCGTGCGGATCGCGTGCGACGGCCCGGTGCTGCTCAACCATCTCGA
TTTCGACCGCCTCGATTTCTTCCTGAGCGGGCCGGATATCCAGGCGCTGCAACTGCTGGAATTGCTGATG
GAGCACCGCGTCGGCATCTTCTGCCAGACTGTCGGCCCGAAACCCTCTCGCGTGGTGCTCGCCGACGACG
CGCTGCGTCAGGAAGGCTTTGAGGCCGACCAGGCGCTGCTGCCGGACGATCTGCGCAATTTCGACGGCTA
CCGCCTGTTGCAGGAATATTTCGCGTTCCCGGCGCGCTTCCAGTTTTTAAGCCTGCGCGGCATCGGTAAG
CTGCTGGCGCAGAGCGGGCAGGCGAACGCGTTCGATATCATCATTCTGCTGGATAAAACCGACACGCCGC
TGGAGCGCGTGGTGGATAAGAGCCACCTCGCGATGCACTGCACGCCGGTCATCAATTTGTTCCCGAAAAT
CGCCGAGCGCCAGAAGCTCACCGAGGGCTTAAGTGAATATCACCTGGTGGTGGATAACATTCGCCCGCTC
GATTACGAGATTTTCTCGGTCAGTAAAATTTATGCCAGCGAAGACGGCCAGCGCGACGACCAGATTTTTC
GCCCGTTCTGGAGCACCTGGAGCCGCGACGGCGGCAACTACGGCGCGTATTTCTCGCTGCGCCGCGAACA
GCGCGCGCTCTCGGAACACGCCCTGCGCTACGGCACGCGTACCGGCTATGTCGGCTCCGAGGCGTTCGTG
TCGCTGGTGGACGCAAGCCACGCGCCGTGGCGCGACGAACTGCGCTATATCACCGCCGAAGTGATGTGCA
CCAGCCGCGATCTGCCGCTGATGCTGGCGCAGGATATGGGCCAGTTTGTGCTGCCGGATTCCATGCCGGT
GCGCGCGCTCACCATGCGTAAAGGGCCGACGCCGCCGCGCCCGGCGCTGGCCGAAGGCTTCAGCACCTGG
CGGCTTATCAGCCAGCTGCAAATGAACTACTTAAGCCTGATGGACGCCGAAGATGGCGAGGGCGCGGCGG
CGCTGCGCCAGCTGCTCGGCCTCTATGCGCGCCTGGCGGAAGCGCCGGTGGCGCGCCAGATTGACGGCAT
TCGCCACTGCGTGCTGGAGCCGGTGCACCGCCGCGTGCCGGAGCCGGGCCCGATTGTGTTCGCCCGCGGC
GTCGGGATTTCGATGACCGTCGATGAGCAGGCGTTTTCCGGCTCCAGCCCGTGGCTGCTTGGCAGCGTGC
TGGAGCGCGTCTTCGCACGCCTGGTCTCCATGAACAGCTTCACCGAGTTCACGCTCAAGAGCCAGCAACG
CGGCGAAGTGGGCTACTGGGGGCCGCGAATGGGTAAAAGGGCGCTGATATGA