SecReT6
Protein ID: 389842834
SecReT6 ID664
T6SS typei3
Gene symbolimpF
Locus tagES15_3834
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4186832..4187404 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDI2EP05
KEGG IDcsk:ES15_3834
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 58..166
Protein Sequence: 190 a.a.     [Download]
>gi|389842834|ref|YP_006344918.1| type VI secretion system protein ImpF [Cronobacter sakazakii ES15]
MNKPYQDDDSGDLLRHGYRSRRNATTVSARDKMQPSLLDRLTDNAPDKRQEPANSNLVSHSALRRQVLRD
LQWLFNTINNEAQQDLSRVDHVRRSVFNFGVAPLAGKRMSEIEWGDIQQRLTEAILHFEPRILPQGLQVR
CVCDTKSLDLHNVLSIEIKGRLWCVPWPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4187404-4186832 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAATAAACCGTATCAGGATGACGACAGCGGCGATCTGCTGCGCCACGGCTATCGTTCGCGCCGCAACG
CCACGACGGTCAGCGCGCGCGACAAAATGCAGCCGTCGCTGCTGGACCGTCTGACCGATAACGCGCCGGA
CAAACGTCAGGAGCCGGCGAACAGCAATCTCGTCTCGCACAGCGCGCTGCGCCGCCAGGTGCTGCGCGAT
TTGCAGTGGCTGTTCAACACCATTAACAACGAAGCGCAGCAGGATCTGAGCCGGGTGGACCACGTGCGCC
GCTCGGTCTTTAACTTCGGCGTGGCGCCGCTTGCAGGCAAGCGGATGTCGGAAATTGAGTGGGGTGACAT
CCAGCAGCGGCTCACCGAGGCGATTTTGCACTTCGAGCCGCGCATTCTGCCGCAGGGGTTGCAGGTGCGC
TGCGTCTGCGACACCAAATCGCTCGACCTGCACAACGTATTATCGATTGAGATTAAAGGCCGCCTGTGGT
GTGTGCCCTGGCCGCTTGAGTTTCTGTTCCGCACCGATGTGGATCTGGAAAACGGCCATTTTGAGCTTAA
AGACGCGGGGTAA