SecReT6
Protein ID: 389842835
SecReT6 ID664
T6SS typei3
Gene symbolimpE2
Locus tagES15_3835
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4187397..4188230 [-]
Producttype VI secretion system protein ImpE
NoteTagJ
UniProt IDI2EP06
KEGG IDcsk:ES15_3835
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.40E-44, Aligned region: 146..268
Protein Sequence: 277 a.a.     [Download]
>gi|389842835|ref|YP_006344919.1| type VI secretion system protein ImpE [Cronobacter sakazakii ES15]
MNTLYQQLAGASVSDALSRLEADIKAQPGNADRRAAFVQFLCLNANWTRALTQLKSWAALAPQAQPTVTL
LQQAIEGEQQRAEVLAGRARPRMPGEQWPWLDLLLKALTETDPARASELRSEALEQAEANPGELTLAVGD
APGEPVRFDWLMDGDARLGPVCELIVNGNYFWVPFSAIASIRFQAPASVTDLVWRHAMVQLVDGTEQVCQ
IPARYPLETGAEDRFLLARTTEWQPLDAEGIHYLGAGQKVWLSGEQEFALLTLDSLAFGLPDDASHE
 
Nucleotide Sequence: 834 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4188230-4187397 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAACACGCTGTATCAACAACTGGCTGGCGCGAGCGTCAGCGACGCGCTGAGCCGTCTTGAGGCCGATA
TCAAAGCCCAGCCGGGCAACGCCGATCGCCGCGCCGCGTTTGTGCAGTTTCTCTGCCTGAACGCCAACTG
GACCCGCGCGCTCACCCAGCTGAAAAGCTGGGCCGCGCTGGCACCGCAGGCGCAGCCGACCGTGACGCTG
CTGCAACAGGCCATCGAAGGCGAGCAGCAGCGCGCCGAAGTGCTGGCAGGCCGCGCGCGTCCGCGTATGC
CGGGCGAACAGTGGCCGTGGCTGGATCTGCTGCTAAAAGCGCTGACAGAAACCGACCCGGCGCGCGCCAG
CGAGCTTCGCAGCGAGGCGCTGGAGCAGGCCGAGGCCAATCCGGGCGAACTGACGCTGGCGGTGGGCGAC
GCGCCCGGCGAGCCGGTGCGTTTTGACTGGCTGATGGACGGCGACGCGCGTCTGGGGCCGGTGTGCGAGC
TTATCGTTAACGGCAACTACTTCTGGGTGCCGTTCAGCGCTATCGCGTCGATTCGTTTCCAGGCTCCGGC
GAGCGTCACCGATCTGGTGTGGCGTCATGCGATGGTGCAGCTGGTGGACGGCACCGAACAGGTCTGCCAG
ATCCCGGCGCGCTACCCGCTGGAAACCGGTGCGGAAGACCGCTTCCTGCTGGCGCGCACCACCGAGTGGC
AGCCGCTGGACGCGGAAGGCATTCACTATCTCGGCGCGGGTCAGAAAGTCTGGCTGAGCGGCGAACAGGA
GTTCGCGCTACTGACGCTGGATAGCCTCGCTTTCGGGCTGCCGGACGACGCATCGCATGAATAA