SecReT6
Protein ID: 389842838
SecReT6 ID664
T6SS typei3
Gene symbol-
Locus tagES15_3838
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4190070..4191986 [-]
Producttype VI secretion system FHA domain-containing protein
NoteFha
UniProt IDI2EP09
KEGG IDcsk:ES15_3838
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.80E-08, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0034, Aligned region: 29..49
UreE_N [PF02814], Evalue: 0.0034, Aligned region: 78..99
Protein Sequence: 638 a.a.     [Download]
>gi|389842838|ref|YP_006344922.1| type VI secretion system FHA domain-containing protein [Cronobacter sakazakii ES15]
MRFTITTNKPGHQPPQSSCDFYPPGGTIGRGTDNNLVLPDNERTISRLQAIVHISADGECRITNRGNVTR
VVLNDIPLERGRQVELQDGDVLGIDDYRIQVSDLALNAQPVIAMAAPKPNVAPQQPQAPQPAKPQQPPKA
DAQDNAPTAVPTEIWDSLMQEFSISDSISQGQSQSARPKTPEAQPFNPFNAPKEADRNPEDPLAHFQSGG
NEPLFGNERVNPDSLFKDDTPFDKDSIFNDVTPTTLVPPSDNRQAAKPQAPHKENEEELDPLALFGGVGS
TPVQSRSDDPLGLMMGGAVPLTPPDELNAGAAPLTPPPAAKQDAEPVKPPVSPEKPQPEMTTSPLAPNAD
DSIDLASLAGSPLFPEEVPEEPVTRVEVQPTPPEVQDYAGITLPTPQAVARSTAQTPKGRLRIDPVQSPT
SQGGTPTASNGDVLNGELLEALLEGMGLGELQPTPQFDRDNMRQLGQMLSMFSQGTVALLSSRSILKRGV
KADMTMVLDDANNPFKLLPSGKTVLMQMFGTRMPGFMPPKKSVRDALIDLQAHQLGMIAGIRAIIAAMLQ
SFNPEQLEEEAKRDGAISRLALPASRKAALWDYFVRHYSDTAGEIEDDFHTLFGEAFLHAYDMEVNQYKD
SQSGSEEE
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4191986-4190070 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCGATTCACGATTACTACCAACAAGCCCGGCCACCAGCCTCCTCAGAGCAGCTGTGACTTCTACCCGC
CGGGCGGCACGATTGGCCGTGGTACGGATAACAATCTGGTACTGCCGGATAACGAAAGAACGATTTCCCG
CCTGCAGGCGATTGTCCATATCTCCGCGGACGGCGAGTGCCGCATCACTAACCGCGGCAACGTCACCCGC
GTGGTGCTGAACGATATTCCGCTGGAGCGCGGCCGCCAGGTGGAGTTACAGGATGGCGACGTACTCGGCA
TTGACGATTACCGCATCCAGGTGAGCGATCTGGCGCTGAACGCGCAGCCGGTTATCGCGATGGCCGCGCC
GAAACCGAACGTCGCGCCGCAGCAGCCTCAGGCGCCGCAGCCTGCGAAACCGCAGCAGCCGCCGAAAGCC
GACGCGCAGGACAACGCGCCGACGGCGGTGCCGACCGAAATCTGGGACAGCCTGATGCAGGAGTTCTCTA
TCTCCGACAGCATCAGTCAGGGGCAGAGCCAGAGCGCGCGCCCGAAAACGCCGGAAGCGCAGCCGTTTAA
CCCGTTCAACGCCCCGAAAGAGGCGGATCGCAACCCGGAAGATCCGCTGGCGCACTTCCAGAGCGGCGGC
AACGAGCCGCTGTTCGGCAATGAAAGGGTCAACCCGGACAGCCTGTTCAAAGATGACACGCCGTTCGATA
AAGACAGCATTTTCAACGATGTGACCCCGACCACGCTGGTGCCGCCGTCTGATAACCGTCAGGCCGCAAA
ACCGCAGGCACCGCATAAAGAGAATGAAGAAGAGCTCGATCCGCTGGCGCTGTTTGGCGGCGTGGGCTCC
ACGCCGGTACAGAGCCGCAGCGACGATCCGCTTGGCCTGATGATGGGTGGCGCTGTGCCGCTGACGCCGC
CGGATGAGCTTAACGCAGGCGCTGCGCCATTAACGCCGCCGCCCGCCGCGAAGCAGGACGCTGAGCCGGT
TAAGCCACCGGTTTCACCCGAAAAACCGCAGCCGGAGATGACGACCTCGCCGCTCGCGCCAAACGCGGAC
GACTCAATCGATCTGGCGTCGCTCGCCGGTTCGCCGCTGTTCCCGGAAGAAGTGCCGGAAGAGCCGGTGA
CGCGCGTGGAAGTCCAGCCGACGCCGCCGGAAGTGCAGGATTACGCGGGTATCACGCTGCCGACGCCGCA
GGCGGTGGCGCGCAGCACCGCGCAGACGCCAAAAGGCCGCCTGCGCATCGACCCGGTGCAGTCGCCGACC
AGCCAGGGCGGCACGCCAACGGCGTCTAACGGCGACGTGCTGAACGGCGAGCTGCTGGAAGCATTGCTGG
AAGGTATGGGGCTTGGCGAGCTGCAACCAACGCCGCAGTTTGACCGCGACAATATGCGCCAGCTCGGCCA
GATGCTCAGCATGTTCTCGCAGGGCACCGTGGCGCTGCTCTCCTCGCGCTCGATTCTCAAGCGCGGCGTG
AAAGCCGACATGACGATGGTGCTGGACGACGCCAACAACCCGTTCAAGCTGCTGCCGTCGGGCAAAACGG
TACTGATGCAAATGTTCGGCACCCGTATGCCGGGCTTTATGCCGCCGAAAAAATCGGTCCGCGATGCGCT
TATCGATCTCCAGGCGCACCAGCTTGGGATGATCGCCGGTATCCGCGCCATCATTGCCGCCATGCTGCAA
TCCTTTAACCCGGAGCAGCTTGAAGAAGAGGCGAAGCGCGACGGCGCTATCTCGCGTCTGGCGCTGCCGG
CGAGCCGCAAAGCCGCGCTGTGGGATTACTTTGTGCGTCATTACAGCGATACCGCGGGCGAGATCGAGGA
CGATTTCCATACTCTGTTCGGCGAAGCCTTCCTGCACGCTTATGACATGGAAGTGAATCAGTACAAAGAC
TCACAAAGCGGATCGGAAGAAGAATGA