SecReT6
Protein ID: 389842841
SecReT6 ID664
T6SS typei3
Gene symbolhcp3
Locus tagES15_3841
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4193062..4193544 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDI2EP12
KEGG IDcsk:ES15_3841
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.90E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|389842841|ref|YP_006344925.1| Hcp1 family type VI secretion system effector [Cronobacter sakazakii ES15]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCSSGKHLTKVELSVCKAGGQQVEYTRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTA
TGGKGAETSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4193544-4193062 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGCTATTGATATGTTCCTGAAAGTAGACGGTGTAACCGGCGAATCTAAAGATTCCAACCACACCGGCT
GGACCGACATCACCTCTTTTTCCTGGGGCGCATCCCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGAATTTCAACGATCTGCACGTTAACGCGCTGATCGACAAATCCACCACCGCTATCCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCGGGCGGCCAGCAGG
TGGAATACACCCGTATCACGCTGGAAGACGTGCTGGTGACTTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTTGGCGTTACTTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACTGCG
ACCGGCGGTAAAGGCGCAGAAACCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA