SecReT6
Protein ID: 389842845
SecReT6 ID664
T6SS typei3
Gene symbolimpC3
Locus tagES15_3845
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4195124..4196623 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDI2EP16
KEGG IDcsk:ES15_3845
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|389842845|ref|YP_006344929.1| type VI secretion system protein ImpC [Cronobacter sakazakii ES15]
MSNPSQQQELQSQQAFSQDEFSALLSKEFRPKTDQARSAVENAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEKLSQQVNQIIHHEEFQKLESAWRGLNYLVNNTETDEMLKIRFMSISKQELGRTLKRFKGVGWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEETDGANHSNYNWAN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLIHRKNSDFAAFIGAQSLQKPAEYHDPDATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4196623-4195124 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAGCAATCCTTCTCAACAGCAAGAGCTGCAATCGCAGCAGGCGTTCAGCCAGGATGAATTCAGCGCGC
TGCTCAGCAAAGAGTTTCGCCCGAAAACCGATCAGGCCCGTTCGGCCGTCGAAAACGCGGTAAAAACCCT
GGCCCAGCAGGCGCTGGAAAACACCGTGACCTTCTCGAACGATACCTACCGCACCATTCAGAACCTGATT
GCCGGTATCGACGAAAAACTGTCTCAGCAGGTTAACCAGATTATCCACCACGAGGAGTTCCAGAAGCTGG
AAAGCGCCTGGCGTGGCCTGAACTATCTGGTCAACAACACGGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGCCGCACCCTGAAACGCTTTAAGGGCGTGGGCTGGGACCAGAGC
CCTATCTTCAAAAAAATCTACGAAGAAGAGTATGGCCAGTTCGGTGGCGAGCCGTTTGGCTGCCTGGTGG
GCGACTACTACTTCGACCACAGCCCGCAGGATGTTGAACTGCTGAGCGAAATGGCGCGCATTGGCGCGGC
GGCGCACTGCCCGTTCATCACCGGCACCGCGCCAAGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCG
AACCCGCGCGACCTGACCAAAATTTTCCAGAACACCGAGTACGCTGCCTGGCGCAGCCTGCGCGAATCGG
AAGATGCGCGCTATCTGGGCCTCGTCATGCCGCGCTTCCTGTCGCGCCTGCCTTACGGCATCCGCACCAA
CCCGGTGGACAGCTTCGACTTCGAAGAAGAGACCGACGGCGCGAACCACAGTAACTACAACTGGGCCAAC
GCGGCCTACGCGATGGCAGCCAACATCAACCGTTCCTTTAAAGAGTACGGCTGGTGCACCTCCATTCGCG
GCGTGGAATCGGGCGGCGCGGTAGAAAACCTGCCGTGTCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAAGCGGAACTGGCGAAAAACGGCTTTATG
CCGCTGATCCACCGCAAAAACTCCGACTTCGCCGCCTTTATCGGCGCGCAGTCGCTGCAAAAACCGGCGG
AATACCACGACCCGGACGCCACCGCGAACGCCCGTCTGGCAGCCCGCCTGCCATACCTGTTCGCCTGCTG
CCGTTTCGCGCACTACCTCAAGTGCATCGTTCGCGACAAGATCGGTTCTTTCCGCGAGCGCGACGAAATG
GAACGCTGGCTGAACGACTGGGTGATGAACTATGTGGACGGCGACCCGGCGAACTCCTCTCAGGAAACCA
AATCCCGTAAGCCGCTGGCGGCAGCCGAGGTGCAGGTTCAGGAGATCGAGGACAACCCGGGCTACTACGC
CGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTGACCGTTTCTCTGCGTCTGGTCTCCAAA
CTGCCGTCGCTGAAGAGCAACGAGGCGTAA