SecReT6
Protein ID: 389842846
SecReT6 ID664
T6SS typei3
Gene symbolimpB2
Locus tagES15_3846
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4196627..4197151 [-]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDI2EP17
KEGG IDcsk:ES15_3846
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-60, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|389842846|ref|YP_006344930.1| type VI secretion system protein ImpB [Cronobacter sakazakii ES15]
MPMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVFADLVGKPVDPQPAVDERKFLEIDIDNF
DERMKALKPRVAFQVDNTLTGEGKLNIDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKVLQDPTLLKSLSQMPKDDDGTKGNEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4197151-4196627 Cronobacter sakazakii ES15 chromosome, complete genome
ATGCCAATGAGTAACAGTGGGCAGAAATTTATCGCCCGTAACCGCGCGCCGCGCGTGCAGATCGAGTACG
ACGTGGAAATCTACGGTGCGGAACGCAAAATTCAGCTTCCGTTTGTAATGGGCGTGTTTGCCGACCTGGT
CGGGAAGCCGGTCGATCCGCAGCCTGCGGTGGACGAACGTAAATTCCTTGAAATTGATATCGACAACTTC
GACGAGCGTATGAAAGCGCTCAAGCCGCGCGTGGCGTTCCAGGTGGACAACACCCTGACCGGCGAAGGCA
AACTGAACATCGATCTCACTTTCGACAGCATGGACGACTTCCTGCCGGACGCCGTCGCGCGTAAGGTCGA
GCCGCTGAACAAGCTGCTGGAAGCCCGTACTCAGCTCTCTAACCTGCTGACCTACATGGACGGTAAAAAC
GGTGCCGAAGAGCTTATCGCGAAAGTGCTTCAGGACCCGACGCTGCTCAAATCGCTGAGCCAGATGCCGA
AAGATGACGATGGCACCAAAGGTAACGAGGAGTAA