SecReT6
Protein ID: 389842847
SecReT6 ID664
T6SS typei3
Gene symbolimpA2
Locus tagES15_3847
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4197227..4198249 [-]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDI2EP18
KEGG IDcsk:ES15_3847
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.20E-21, Aligned region: 52..111
Protein Sequence: 340 a.a.     [Download]
>gi|389842847|ref|YP_006344931.1| type VI secretion system protein ImpA [Cronobacter sakazakii ES15]
MDIETLLTPVSPEQPCGDNLEYDADYQAMEQASQGKAEQQFGDTIIPAEPADWTKVEKLALSLLERTKDL
RVMLALTHAWTKRRGLPGYADGLLLIQEALTRYWEPLYPLLEEYGEKDPFYRINALAGLGDKSSLTSTLR
TATLLRSNGDEITLRDAQSLLDNSKSECPGYPGGRPRLVDELARGGQPGIEAIVQIHARLEAIRTILVSH
LGESGVPEMEQLQKLTSIVALACQSGEPQAPQELQDPDVQAENAPAATTTSAPARVVETDWRNVQLQTRD
DAQLMLEKVKQYFARHEPSHPAPLMIERVQRLIEMNFMDLIRDLAPDSVHQVENIFGRRE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4198249-4197227 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGATATTGAAACCCTTCTTACTCCGGTGAGCCCGGAGCAGCCGTGCGGCGACAACCTGGAGTACGACG
CCGATTACCAGGCGATGGAACAGGCAAGCCAGGGCAAGGCGGAACAGCAGTTCGGCGACACCATTATTCC
GGCAGAGCCGGCGGACTGGACTAAAGTTGAAAAGCTGGCCCTGTCGTTGCTTGAGCGCACCAAAGATCTG
CGCGTCATGCTGGCGCTGACCCACGCATGGACCAAACGCCGCGGCCTGCCGGGCTATGCCGACGGGCTGC
TGCTGATTCAGGAAGCGCTGACGCGCTACTGGGAGCCGCTCTATCCGCTGCTGGAAGAGTACGGCGAAAA
AGATCCGTTCTACCGTATTAACGCGCTGGCGGGGCTTGGCGATAAATCCTCCCTGACCAGCACGCTGCGC
ACCGCGACGCTGCTGCGCAGCAACGGCGACGAAATTACGCTGCGCGACGCGCAGTCGTTGCTCGACAACA
GCAAAAGCGAATGTCCGGGTTATCCGGGCGGCCGCCCGCGGCTGGTGGATGAACTCGCGCGCGGCGGCCA
GCCGGGCATCGAGGCGATAGTCCAGATCCATGCGCGACTGGAAGCGATTCGCACCATTCTCGTCAGCCAT
CTCGGTGAGAGCGGCGTGCCGGAGATGGAGCAGCTCCAGAAGCTGACGAGCATTGTGGCGCTGGCCTGCC
AGAGCGGCGAACCCCAGGCGCCGCAGGAGTTACAAGACCCGGACGTGCAGGCGGAGAATGCGCCTGCCGC
CACGACGACCAGCGCCCCGGCGCGGGTGGTTGAAACCGACTGGCGCAACGTGCAACTGCAAACGCGCGAT
GACGCCCAGTTAATGCTTGAGAAAGTGAAGCAATATTTTGCCCGGCACGAGCCGAGCCACCCCGCGCCGC
TGATGATTGAGCGCGTGCAGCGACTGATTGAAATGAATTTCATGGATCTTATTCGCGACCTGGCGCCCGA
CAGTGTGCATCAGGTGGAAAACATTTTCGGACGCCGCGAGTAA