SecReT6
Protein ID: 389842850
SecReT6 ID664
T6SS typei3
Gene symbolimpK2
Locus tagES15_3850
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4202608..4203843 [-]
ProductOmpA family protein
NoteTssL
UniProt IDI2EP21
KEGG IDcsk:ES15_3850
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 19..224
DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 363..388
OmpA [PF00691], Evalue: 1.50E-15, Aligned region: 289..387
Protein Sequence: 411 a.a.     [Download]
>gi|389842850|ref|YP_006344934.1| OmpA family protein [Cronobacter sakazakii ES15]
MEPQATGSDAILSGASSNNPLVAAANPLLNAIPQIRHSVSHEDQAGLRQRLIDEIRRFEVRCQQAALPYE
VIVGARYCLCTALDEAAALTPWGSRGVWSGSGLLVTFHNETWGGEKFFQLLARLSQNPREHIFLLEMINY
CLLLGFEGRYRVMDNGRTQLETIKQRLWQMIRSVRGSYPPPLSSHPEDQPVLRKLWRPVVPLWACVALAG
FLACLFFIILNWRLGDNTSPVLAKIYQTPLPEVTVQQPAREVAPVLNLRGFLRPEIEAGLVAVRDEADRS
VVILKGDGLFASASTVVRGRYEPVIDRVAQAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAESVQ
KMLQAHLADPNRVKAQGRGEMDPIAPNNTPENRARNRRVEITLLVSPDNTLAELNGLPQGN
 
Nucleotide Sequence: 1236 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4203843-4202608 Cronobacter sakazakii ES15 chromosome, complete genome
ATGGAACCACAAGCCACCGGCAGCGATGCCATTCTTTCCGGCGCCAGCAGTAATAATCCGCTGGTCGCGG
CGGCCAACCCGCTGCTTAACGCGATCCCGCAGATTCGTCATTCTGTATCGCATGAAGATCAGGCCGGGCT
GCGCCAGCGCCTGATCGACGAGATCCGCCGCTTTGAAGTGCGCTGCCAGCAGGCGGCGCTGCCTTACGAA
GTGATCGTCGGCGCGCGCTACTGCCTGTGTACGGCGCTGGATGAAGCGGCTGCGCTCACGCCGTGGGGCA
GCCGTGGCGTCTGGTCAGGCAGCGGTCTGCTGGTGACGTTCCACAACGAAACCTGGGGCGGCGAGAAATT
CTTTCAGCTTCTGGCGCGGCTGTCGCAAAACCCGCGCGAGCACATCTTCCTGCTGGAGATGATCAACTAC
TGCCTGCTGCTCGGCTTCGAAGGGCGCTATCGCGTCATGGATAACGGCCGCACGCAGCTTGAAACCATCA
AACAGCGTCTGTGGCAGATGATCCGCAGCGTGCGCGGCAGCTATCCGCCGCCGCTCTCGTCGCACCCGGA
AGATCAACCGGTGCTGCGCAAGCTCTGGCGTCCGGTGGTGCCGCTGTGGGCCTGCGTGGCGCTGGCCGGT
TTCCTGGCGTGCCTGTTCTTTATCATTCTTAACTGGCGGCTTGGTGATAACACCAGCCCGGTGCTGGCGA
AGATTTACCAGACGCCGCTGCCGGAAGTCACCGTTCAGCAACCCGCGCGTGAAGTGGCGCCGGTGCTTAA
CCTGCGCGGTTTCCTGCGTCCGGAAATTGAAGCGGGCCTGGTGGCGGTGCGCGACGAGGCCGACCGCAGC
GTGGTGATTCTGAAAGGCGACGGCCTGTTCGCCTCTGCCTCAACGGTCGTGCGTGGCCGTTATGAACCGG
TTATCGACCGCGTGGCGCAGGCGATGAACAACGTCAGCGGCAAAATCCTCGTGGTGGGCTACAGCGACAA
CGTGCCTATCCGCAGCGCGCGTTTCGCCTCGAACTACGAGCTGTCGCTCGCGCGCGCCGAATCGGTACAG
AAAATGCTCCAGGCGCACCTCGCCGACCCGAACCGCGTTAAAGCGCAGGGCCGCGGCGAGATGGACCCTA
TCGCTCCGAACAATACGCCGGAAAACCGCGCCCGCAACCGCCGTGTCGAGATAACGCTGCTGGTGTCGCC
GGATAACACACTGGCCGAGCTGAACGGATTGCCGCAAGGAAACTAG