SecReT6
Protein ID: 389842851
SecReT6 ID664
T6SS typei3
Gene symbolimpJ2
Locus tagES15_3851
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4203861..4205204 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDI2EP22
KEGG IDcsk:ES15_3851
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-143, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|389842851|ref|YP_006344935.1| type VI secretion system protein ImpJ [Cronobacter sakazakii ES15]
MNKAEKVVWTEGMFLRPHHFQRAESFLQHHIREWGSLQRPYLWGFLDLEFDEAMLRQGRVALSYASGLLP
DGTPFSFRDARHGPAPLAIPDNLTHERVVLALPARRAGREEVIFSEAADSLARYATFEEEVEDDNALSVG
AATVQFGRLRLKLMLESELTAEWTAIGVAQVIEKRNDNQVRLDTSYIPPMLNAINSGQLYSMLNDLHGLL
GQRSQQISQRLRQPGRFNTSEMVEFMLLSLINHHLGHVTHLKTLPLLHPETLWRDWLAFACELTTWTAQR
APETTLPVYDHDNLAGCFGKLTLMLRQGLSLVMEESAIQLPLTERSHGLNVATVPESNMVREFGFVLAVK
ANVPGEALQTHFPAQMKVAPVTKIRDLVQLQLPGMVLRAMPVAPPQIPWHAGYSYFELEKGGELWKEMEK
SGAFALHLAGEFPGLDMEFWAIRSTNE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4205204-4203861 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAACAAAGCAGAAAAAGTGGTCTGGACCGAAGGGATGTTCCTGCGTCCGCACCACTTCCAGCGCGCGG
AAAGTTTTCTGCAACACCACATCCGCGAATGGGGTTCGTTGCAGCGTCCGTATCTCTGGGGATTTCTCGA
TCTGGAATTTGACGAGGCGATGCTGCGTCAGGGACGCGTGGCGCTGAGCTACGCCAGCGGCCTGCTGCCG
GACGGCACGCCGTTCTCTTTTCGCGACGCCCGCCACGGCCCGGCGCCGCTCGCCATTCCCGACAACCTCA
CGCACGAGCGCGTGGTGCTGGCGCTGCCCGCCCGCCGCGCCGGACGCGAAGAGGTGATTTTCAGCGAGGC
GGCCGATTCGCTCGCCCGCTACGCCACCTTTGAAGAAGAAGTGGAAGACGACAACGCGCTGTCGGTCGGC
GCGGCGACGGTACAGTTTGGCCGCCTGCGTCTCAAGCTGATGCTGGAGAGCGAACTGACCGCCGAGTGGA
CGGCCATTGGCGTCGCGCAGGTGATTGAAAAGCGCAACGACAACCAGGTGCGCCTCGATACCAGCTACAT
TCCGCCGATGCTCAACGCCATCAACAGCGGGCAACTCTACAGCATGCTCAACGATCTGCATGGTCTGCTC
GGTCAGCGCAGCCAGCAAATCAGCCAGCGTCTGCGCCAGCCGGGGCGGTTTAACACCTCGGAGATGGTGG
AGTTCATGCTGCTGTCGCTGATTAACCATCATCTCGGCCACGTCACGCATTTAAAAACGCTGCCGTTGCT
CCACCCGGAAACCCTGTGGCGTGACTGGCTGGCGTTCGCCTGCGAACTCACCACCTGGACGGCGCAGCGC
GCGCCGGAGACGACGCTGCCGGTCTATGACCACGACAACCTGGCGGGCTGCTTTGGCAAACTGACGCTGA
TGCTGCGCCAGGGGCTGTCGCTGGTAATGGAAGAGAGCGCCATTCAGCTGCCGCTCACCGAGCGTTCGCA
CGGGCTCAACGTCGCCACCGTGCCGGAAAGCAACATGGTGCGCGAGTTCGGTTTCGTGCTGGCGGTCAAA
GCCAACGTGCCGGGCGAGGCGCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTCACCAAAA
TTCGCGATCTGGTGCAGTTGCAGTTGCCGGGTATGGTGCTGCGCGCCATGCCGGTTGCGCCGCCGCAGAT
CCCGTGGCATGCCGGCTACAGCTATTTCGAACTGGAAAAGGGCGGCGAACTCTGGAAAGAGATGGAGAAA
TCCGGCGCGTTTGCGCTGCATCTCGCTGGTGAATTCCCGGGCCTTGATATGGAGTTTTGGGCCATTCGCA
GTACGAATGAATAA