SecReT6
Protein ID: 389842852
SecReT6 ID664
T6SS typei3
Gene symbolvasD3
Locus tagES15_3852
StrainCronobacter sakazakii ES15
Repliconchromosome [GenBank: NC_017933] [Browse all T6SS(s) in this replicon]
Location [Strand]4205229..4205735 [-]
Producttype VI secretion lipoprotein, VC_A0113 family 2
NoteTssJ
UniProt IDI2EP23
KEGG IDcsk:ES15_3852
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-32, Aligned region: 20..159
Protein Sequence: 168 a.a.     [Download]
>gi|389842852|ref|YP_006344936.1| type VI secretion lipoprotein, VC_A0113 family 2 [Cronobacter sakazakii ES15]
MKNRTVLRQGFLAFLIAALTLLSGCLSSSRSVPSQYSLHFQAHPQINNSAPLKVRVLLLKSDADFMSADF
FSLQNNAQTVLGANLLNSDEFFLMPGQLNKTLSGQSSLDARYIGVMAEYQALDGKKWRISLPLPAPSDSS
IYKFWKWSSDELEAKVFLDVNGIRVINE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|389839000|ref|NC_017933.1|:c4205735-4205229 Cronobacter sakazakii ES15 chromosome, complete genome
ATGAAAAACCGTACCGTTTTACGCCAGGGCTTCCTGGCGTTTTTGATTGCCGCTCTCACCTTACTGAGCG
GCTGCTTATCGTCTTCACGCAGCGTTCCTTCCCAGTACAGCCTGCATTTTCAGGCTCACCCGCAAATTAA
TAATTCCGCCCCGCTAAAAGTCCGGGTGCTGCTTTTGAAATCAGACGCCGACTTTATGTCTGCGGATTTC
TTTTCGCTGCAAAACAATGCTCAGACCGTGCTGGGAGCCAACCTGCTCAACAGCGACGAGTTCTTCCTGA
TGCCGGGCCAGCTGAACAAAACCCTCAGCGGCCAGAGCTCGCTTGACGCGCGCTACATCGGCGTGATGGC
GGAATATCAGGCGCTCGACGGCAAAAAATGGCGAATCTCGCTCCCGCTGCCCGCCCCCAGTGACTCCAGC
ATTTATAAATTTTGGAAATGGTCATCCGACGAACTTGAGGCAAAAGTGTTTCTTGACGTCAATGGGATCC
GCGTCATCAACGAATAA