SecReT6
Protein ID: 389873865
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23545
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4054493..4055047 [-]
Producthypothetical protein
NoteTssE
UniProt IDI3UH14
KEGG IDaka:TKWG_23545
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.80E-20, Aligned region: 51..162
Protein Sequence: 184 a.a.     [Download]
>gi|389873865|ref|YP_006381284.1| hypothetical protein TKWG_23545 [Advenella kashmirensis WT001]
MDMEDISGKRTAFGMRERRAAKDRLQPALLDRLTDNEPLKKKESRDSVMITYDTLRHAVLRDLRWVLNTV
NIETVDDLDAFPQVRNSTVNFGVEALAGRRMSEIDWVDMEQSIKTAIIHFEPRILSDSLEVACVSEVTSL
EHHNVLSLEIRGKLWCNPYPREFLFRTDIDLESGHMDLQEQGAA
 
Nucleotide Sequence: 555 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4055047-4054493 Advenella kashmirensis WT001 chromosome, complete genome
ATGGATATGGAAGACATTTCAGGTAAACGAACGGCCTTCGGCATGCGTGAGCGTCGCGCAGCCAAGGATC
GTTTGCAGCCGGCATTGCTGGATCGCCTTACCGACAATGAACCGCTGAAAAAAAAGGAAAGTCGCGACAG
CGTTATGATCACGTACGATACGCTGCGCCATGCGGTGCTGCGTGACCTGCGCTGGGTGTTGAACACGGTC
AATATTGAAACCGTGGACGACCTGGATGCCTTTCCCCAGGTACGCAATTCAACGGTCAATTTCGGCGTCG
AAGCCCTGGCCGGCAGGCGCATGTCCGAGATTGACTGGGTTGATATGGAGCAGTCCATCAAGACGGCCAT
TATTCATTTCGAACCGCGAATTCTGTCCGATTCGCTGGAAGTGGCTTGTGTCAGCGAAGTGACCTCGCTG
GAGCATCACAATGTGCTCAGCCTGGAGATCCGCGGCAAACTTTGGTGCAATCCCTATCCGCGCGAATTTT
TGTTCCGTACCGACATTGATCTGGAAAGCGGTCATATGGATCTGCAGGAACAGGGGGCTGCCTGA