SecReT6
Protein ID: 389873866
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23550
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4055111..4055932 [-]
Producthypothetical protein
NoteTagJ
UniProt IDI3UH15
KEGG IDaka:TKWG_23550
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.60E-43, Aligned region: 141..267
Protein Sequence: 273 a.a.     [Download]
>gi|389873866|ref|YP_006381285.1| hypothetical protein TKWG_23550 [Advenella kashmirensis WT001]
MTGIIKALDGKSVDEQLDQVKAQIRKKPADADLRARLFQLLAVKGLWDKAFEQLKLSSEMNAQAQPVAVL
YTGAITAEQEREAVFRGEKTPAVFEQPPEWMAMLLEALRSDAETAHALREQALEAAPAVSGTVVVNDQEQ
GQPFEWLCDGDSRLGPVCEVIANGRYGWVPMDMIQSLRLIPPEGLTDLIWVQAEITLVSGRSQIGLIPAR
YPAPADKNYADLDDASNLSRRTDWQQISQDIYFGTGQKMWMTDAGEYALLDMRSVTFHHGQLN
 
Nucleotide Sequence: 822 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4055932-4055111 Advenella kashmirensis WT001 chromosome, complete genome
ATGACAGGCATCATAAAGGCACTGGACGGCAAGAGCGTTGATGAACAGCTCGATCAGGTGAAGGCTCAAA
TAAGAAAAAAACCGGCTGACGCCGATCTGCGTGCCCGGCTGTTCCAGTTGCTGGCCGTCAAGGGATTATG
GGACAAGGCTTTCGAGCAATTGAAACTGAGTTCGGAAATGAATGCCCAGGCCCAGCCCGTTGCAGTGCTT
TATACTGGCGCCATAACGGCAGAGCAGGAACGCGAAGCCGTCTTTCGTGGCGAGAAAACGCCGGCGGTCT
TCGAACAGCCGCCCGAGTGGATGGCCATGCTGCTTGAGGCCTTGCGCAGTGACGCCGAGACGGCGCACGC
CCTGCGGGAACAGGCGCTGGAAGCGGCGCCAGCTGTTTCAGGTACGGTTGTGGTCAATGACCAGGAACAG
GGACAGCCCTTTGAATGGCTGTGCGACGGCGACAGCCGCCTTGGTCCGGTGTGCGAGGTTATTGCCAACG
GCCGCTATGGCTGGGTTCCCATGGATATGATCCAGTCGTTGCGCCTGATTCCGCCTGAAGGGCTGACCGA
TCTGATCTGGGTTCAGGCCGAAATCACGCTTGTGAGCGGTCGTTCGCAGATCGGCCTGATTCCGGCGCGT
TATCCGGCGCCTGCCGATAAAAATTATGCCGATCTGGACGATGCCAGCAATCTGTCGCGTCGGACAGACT
GGCAGCAGATCAGCCAGGACATCTATTTCGGAACCGGACAGAAAATGTGGATGACCGATGCGGGCGAGTA
TGCGTTGCTGGATATGCGCAGCGTCACGTTTCATCATGGGCAGTTGAACTGA