SecReT6
Protein ID: 389873867
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23555
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4056047..4056532 [-]
Producthypothetical protein
NoteTssD
UniProt IDI3UH16
KEGG IDaka:TKWG_23555
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-38, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|389873867|ref|YP_006381286.1| hypothetical protein TKWG_23555 [Advenella kashmirensis WT001]
MAVDMFMKIEGANGESKDSNHKDWSDIQSFAWGATQPGSMATGGGGGTGKASFNDLNVVARVDRAAPAVM
KHCSTGKHLSKVEVSVCKAGGTQVEYSKITLEDVLVTSVQYTGAHDGDAMMVSYAFQAAKVKQQYWEQTE
QGGKGAESVVAYDVKQNKIVG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4056532-4056047 Advenella kashmirensis WT001 chromosome, complete genome
GTGGCTGTTGATATGTTTATGAAAATTGAAGGTGCAAACGGTGAATCCAAGGATTCAAACCACAAGGACT
GGAGCGACATTCAGTCTTTCGCATGGGGTGCAACACAACCCGGTTCCATGGCTACCGGTGGTGGTGGCGG
TACTGGCAAAGCCAGCTTTAACGACCTGAATGTTGTTGCCCGTGTTGACCGTGCTGCACCTGCAGTGATG
AAACACTGCTCTACCGGTAAACACCTGAGCAAGGTCGAAGTATCTGTATGCAAGGCCGGTGGTACACAAG
TGGAATACTCCAAAATTACGCTGGAAGACGTTCTGGTGACTTCTGTTCAATACACAGGCGCACACGACGG
TGATGCCATGATGGTTAGCTATGCGTTCCAGGCTGCCAAAGTCAAACAGCAGTACTGGGAGCAAACAGAG
CAGGGCGGCAAAGGTGCTGAATCTGTTGTTGCCTATGACGTCAAACAAAACAAAATCGTCGGTTAA