SecReT6
Protein ID: 389873868
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23560
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4056721..4058217 [-]
Producthypothetical protein
NoteTssC
UniProt IDI3UH17
KEGG IDaka:TKWG_23560
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-197, Aligned region: 65..491
Protein Sequence: 498 a.a.     [Download]
>gi|389873868|ref|YP_006381287.1| hypothetical protein TKWG_23560 [Advenella kashmirensis WT001]
MSTSVQKEAVQLEGLESDGLASLLKKEFKPKTDQAREAVENAVRTLAEQALANTVTMSSDAYSTIQAIIA
EIDHKLSEQINLIMHNDEFQKLEGAWRGLHYLVNNSETDELLKIRVMCITKKELGRTLKRYKGVGWDQSP
IFKRVYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMARISAAAHCPFISGASPEVMQMDSWQELAN
PRDLTKIFTNSEYAAWRSLRESEDSRYIGLAMPRFLARLPYGSRTNPVDEFDFEEDTDGATHERYTWANS
AYAMASNINRSFKEYGWCTSIRGVESGGAVEDLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPHEYNDPDATANARLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDDME
RWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVTEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKQNDS
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4058217-4056721 Advenella kashmirensis WT001 chromosome, complete genome
ATGAGCACGAGCGTACAGAAAGAAGCGGTACAGTTAGAAGGACTGGAATCCGATGGTCTCGCTTCATTAC
TGAAAAAAGAATTCAAGCCCAAGACTGACCAGGCGCGCGAAGCGGTAGAGAACGCGGTGCGCACGCTGGC
CGAGCAGGCGCTGGCCAACACGGTCACTATGTCTTCGGACGCCTATTCGACCATCCAGGCGATTATTGCG
GAGATTGATCACAAGCTGTCCGAGCAGATCAATCTGATTATGCACAACGATGAATTCCAGAAGCTTGAAG
GCGCCTGGCGCGGCCTGCATTATCTGGTCAACAATTCAGAAACAGACGAACTGTTGAAAATCCGCGTCAT
GTGCATCACCAAGAAGGAACTGGGCCGCACCCTCAAACGCTATAAGGGCGTCGGCTGGGACCAGAGCCCG
ATTTTCAAGCGTGTTTACGAAGAAGAATACGGCCAGTTTGGTGGTGAGCCCATCGGCTGCATTGTGGGCG
ATTATCACTTTGATCATAGCCCGCCAGACGTTGAGCTGCTGGGTGAAATGGCACGCATCTCTGCCGCAGC
CCACTGCCCATTCATTTCCGGTGCGTCGCCTGAAGTCATGCAGATGGATTCCTGGCAGGAACTGGCCAAT
CCGCGCGATCTGACCAAAATCTTTACCAATTCGGAATATGCCGCCTGGCGTAGTTTGCGCGAGTCAGAAG
ACTCACGCTATATCGGTCTGGCGATGCCGCGCTTCCTGGCCCGTCTGCCTTACGGCTCACGCACCAACCC
GGTGGATGAGTTCGACTTTGAAGAGGACACCGACGGCGCAACGCATGAGCGATATACCTGGGCTAACTCG
GCCTACGCCATGGCGTCCAACATCAACCGTTCCTTCAAGGAATACGGCTGGTGCACTTCGATTCGTGGCG
TTGAATCTGGCGGGGCGGTCGAAGATCTGCCTTGCCACACCTTCCCCACCGATGATGGCGGCGTCGATAT
GAAATGCCCCACGGAAATTGCTATCAGCGATCGGCGCGAGGCCGAGCTGGCCAAAAACGGCTTCATGCCG
CTGGTGCATCGCAAGAACTCAGACTTTGCCGCCTTCATCGGTGCGCAGTCGCTGCAAAAGCCCCACGAAT
ATAACGACCCGGATGCCACCGCCAATGCCCGCTTGTCGGCCCGCCTGCCGTATCTGTTTGCATGCTGCCG
CTTTGCGCATTATCTCAAGTGTATTGTGCGCGACAAAATCGGTTCCTTCCGCGAGCGTGACGATATGGAA
CGCTGGCTTAATGACTGGATCATGAATTATGTCGATGGTGATCCGGCCAACTCGTCCCAGGAAACCAAAG
CGCGCAAGCCTTTGGCTGCCGCTGAAGTCCAGGTTACCGAGATTGAAGACAACCCAGGCTATTACGCTGC
CAAGTTCTTCCTGCGTCCGCATTATCAGCTCGAAGGCCTGACAGTGTCGCTGCGTCTTGTTTCAAAACTG
CCGTCGCTTAAACAGAACGACAGCTGA