SecReT6
Protein ID: 389873869
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23565
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4058231..4058785 [-]
Producthypothetical protein
NoteTssB
UniProt IDI3UH18
KEGG IDaka:TKWG_23565
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-59, Aligned region: 11..164
Protein Sequence: 184 a.a.     [Download]
>gi|389873869|ref|YP_006381288.1| hypothetical protein TKWG_23565 [Advenella kashmirensis WT001]
MSSRRSGQKFIARNRAPRVQIEYDVEIYGAERTIQLPFVMGVMADLAGKSEVPQADINDRKFLEVDIDNF
DERMKAIKPRVAFQVPNTLTGEGVLSVDMSFDSIDDFSPAQVARKVDALKELLEARTELANLLTYMDGKT
GAEELINKVLKNPALMKTLAAAPNKDTSAPEADKPESDADDTSK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4058785-4058231 Advenella kashmirensis WT001 chromosome, complete genome
ATGTCGTCACGCAGAAGCGGTCAGAAGTTCATTGCACGAAACCGCGCTCCGCGTGTGCAGATCGAATATG
ACGTTGAAATCTATGGTGCCGAAAGAACCATTCAGTTGCCGTTTGTCATGGGCGTCATGGCCGATCTTGC
CGGTAAATCCGAAGTGCCGCAGGCCGATATCAACGACCGCAAATTTCTTGAAGTAGACATCGATAATTTC
GATGAACGCATGAAGGCCATCAAGCCGCGCGTGGCGTTTCAGGTTCCCAACACCCTGACCGGCGAAGGTG
TGCTCAGTGTGGACATGAGCTTTGACAGCATCGACGATTTTTCACCGGCACAGGTGGCGCGCAAGGTCGA
TGCGCTTAAAGAATTGCTGGAAGCGCGTACTGAGCTGGCCAATCTGCTGACCTATATGGATGGCAAAACC
GGCGCCGAAGAACTCATCAACAAGGTACTGAAGAACCCGGCCTTGATGAAAACGCTGGCAGCAGCGCCGA
ACAAGGATACATCTGCCCCCGAGGCTGACAAGCCTGAATCCGACGCAGACGACACCAGTAAGTAA