SecReT6
Protein ID: 389873870
SecReT6 ID666
T6SS typei3
Gene symbol-
Locus tagTKWG_23570
StrainAdvenella kashmirensis WT001
Repliconchromosome [GenBank: NC_017964] [Browse all T6SS(s) in this replicon]
Location [Strand]4058857..4059906 [-]
Productprotein ImpA
NoteTssA
UniProt IDI3UH19
KEGG IDaka:TKWG_23570
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-14, Aligned region: 52..111
Protein Sequence: 349 a.a.     [Download]
>gi|389873870|ref|YP_006381289.1| protein ImpA [Advenella kashmirensis WT001]
MKTFDELFSAFSEDNAGENLEYDAAFLALQQAVVEKPEQQFGDTIIDAQAPDWNQVEKQALALCDRTCDL
RVIHALVCAWTSQNGLAGYACGVRLAHDALEKCWVSVYPQLVEDDYEDPLPRINALNSLADMQGVGRSVR
SANLLTGAHGQLSLRDAESIMEGSRADLFPGGRARLVETLNQAAIAGAPEMVGLGSAAKSLQSIIELVTE
KLGTEWTPSVSSLQRSFELITNALGAAATSQSEQPESTAADNNGGQGVVEPAAGNTATVQQQAVERPVSW
TEVQIKTRDEAMVALEKVSSYFEIHEPSHPAPFLIRRVQQTIPLNFHEMLKNLTPGNAEQFENWLPREE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|389870301|ref|NC_017964.1|:c4059906-4058857 Advenella kashmirensis WT001 chromosome, complete genome
ATGAAAACATTTGATGAATTGTTCTCTGCGTTTAGCGAAGACAACGCTGGCGAGAATCTGGAGTACGATG
CCGCTTTTTTGGCGTTACAGCAGGCAGTTGTAGAAAAGCCCGAACAACAGTTTGGCGATACGATTATTGA
TGCTCAGGCTCCGGATTGGAATCAGGTTGAAAAGCAGGCACTTGCGCTTTGTGACAGAACTTGCGATTTG
CGCGTGATTCACGCACTGGTTTGCGCGTGGACGTCGCAAAATGGGCTTGCAGGCTATGCCTGCGGTGTCC
GATTGGCGCACGATGCTTTAGAAAAATGCTGGGTGAGTGTTTATCCGCAATTGGTTGAAGATGATTATGA
AGATCCGTTGCCACGCATCAACGCATTGAATTCTCTGGCGGATATGCAGGGTGTGGGGCGCAGCGTACGC
AGCGCCAACCTGCTCACCGGTGCACATGGCCAGTTGTCATTGCGTGATGCTGAATCCATTATGGAAGGCT
CGCGCGCCGATCTGTTTCCCGGTGGCCGGGCCCGATTGGTGGAAACGCTGAACCAGGCTGCCATTGCTGG
TGCGCCGGAAATGGTCGGGCTGGGCAGCGCGGCAAAAAGCCTGCAGAGCATTATAGAGCTGGTCACCGAA
AAGCTGGGCACCGAGTGGACGCCTTCAGTCTCATCATTGCAGCGAAGTTTTGAATTGATCACAAATGCAT
TAGGTGCTGCTGCAACATCGCAATCGGAACAACCTGAGAGCACTGCTGCAGACAACAATGGCGGGCAAGG
TGTGGTTGAACCCGCCGCTGGCAATACAGCAACAGTGCAACAGCAAGCAGTGGAAAGGCCGGTGTCATGG
ACGGAAGTACAAATCAAGACGCGCGACGAGGCAATGGTCGCACTGGAAAAAGTCAGCAGTTATTTTGAAA
TTCACGAACCGAGCCATCCGGCTCCGTTCCTGATCCGGCGGGTTCAGCAGACCATTCCCCTTAATTTTCA
TGAAATGCTGAAAAATCTTACCCCCGGTAATGCCGAGCAGTTTGAAAACTGGCTGCCCCGCGAAGAGTAA