SecReT6
Protein ID: 389875320
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0068
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]66195..68924 [-]
ProductvgrG protein
NoteTssI
UniProt IDI3TRT3
KEGG IDtmo:TMO_a0068
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.60E-70, Aligned region: 45..349
Phage_base_V [PF04717], Evalue: 8.80E-24, Aligned region: 388..480
Protein Sequence: 909 a.a.     [Download]
>gi|389875320|ref|YP_006373055.1| vgrG protein [Tistrella mobilis KA081020-065]
MMEGGLGSLGGAPISSAPIQDGRLLVLDTSLGRDVFLLEKLEGFEALSTLFRFELRVRATREDVAPDELI
GRPVGFSLELPQGSAGGTRRHWCGIVTELSADEAVARGRRAYTLVVRPWTWLLTQTSDCRIFQDMTSLEI
MRRIFTENGFQDFDFGGVINTPPKRDYCVQYRETDFDFVARLMEEDGLFWTFRHREDAHVLVVADGVHAY
QPAADEVLRFAPTDVDLNGVIRWDRHFRFVTGAVARSDYDYEAPEVDLAGRAGSVAGLTTNGPYEIYDWH
GRHLTPESGRRGAARWMAAIESDVDHVEALATNRCLAPGDMFTLTGHPSEVENGSPHVVTAVSHRASAEG
YEVGTAGDAPRYAAEFRAIPAATRYVTPETTPRPAIDGIQTATVVGPKGEEIHTDRYGRIKVRFPWDRYA
TGDDRSSCWIRVMQPWGGRGMGVQTIPRIGMEVMVAFIEGDPDRPLVVGTVPNAETMPPLTLPATKTRTS
FKSTTSPGGGGFNELSFEDLAGAEELLFRAQRDHARMAGRNRMINTANVSTEDTNTLWGSAVGNSEVVKT
RANVLIQHVMSRIILDGERVRFEHTNGHFFDLSAEGISFSSTNKLLQLRNTDNFIFVNKDGVVRKGKVLL
DEDAGGTSSVTISADGVGSNGPLVMLNCGPAYGDYVQNQPATPGTEGDREAWKAEGDAWAGTRDGDGGTA
RVMGGEGSITADDGRVEAEFKGGGAFLDGDLEGEYGSVGGKLNVLGAEGKGHAGVGYGAGAYGEARASMV
DANVRGALGDLETGGVGGQAEYRQMAASAKGEILLGDDGRRAGLALGGMASASALEGGLQGDVTIPIGWL
PWVPDDYTINLQGRLTGAAGTVAASAGGFGYYDYGGDGRVHGGAYAKLGAILGAGVRLKGSIGPSGGGD
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c68924-66195 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGATGGAAGGTGGTCTCGGAAGCCTGGGAGGGGCGCCGATCTCCTCGGCGCCGATCCAGGACGGCCGGC
TGCTGGTGCTGGACACGAGCCTTGGCCGCGACGTCTTCCTGCTGGAAAAGCTGGAAGGCTTCGAGGCGCT
GTCCACCCTGTTCCGCTTCGAACTGCGGGTGCGGGCGACGCGCGAGGATGTCGCCCCCGACGAGCTGATC
GGCCGGCCGGTGGGGTTTTCGCTGGAACTGCCCCAGGGATCGGCCGGCGGCACGCGGCGCCACTGGTGCG
GCATCGTGACCGAGCTTTCCGCCGACGAGGCGGTCGCCCGCGGACGGCGCGCCTATACGCTGGTGGTCAG
GCCCTGGACCTGGCTGCTGACCCAGACATCGGATTGCCGGATCTTCCAGGACATGACCAGCCTGGAGATC
ATGCGCCGGATCTTCACCGAGAACGGCTTTCAGGATTTCGATTTCGGCGGCGTGATCAACACCCCGCCCA
AGCGCGATTATTGCGTCCAGTATCGCGAGACCGATTTCGACTTCGTCGCCCGGCTGATGGAAGAGGACGG
GCTGTTCTGGACCTTCCGCCACCGCGAAGATGCCCATGTGCTGGTGGTGGCCGATGGCGTGCATGCCTAT
CAGCCGGCCGCCGACGAGGTGCTGCGCTTCGCCCCCACCGATGTCGACCTGAACGGGGTGATCCGCTGGG
ACCGGCATTTCCGCTTCGTGACCGGCGCGGTCGCCCGGTCGGATTATGACTACGAGGCGCCGGAGGTGGA
TCTTGCCGGCCGGGCCGGATCGGTCGCCGGGCTGACGACCAACGGACCTTACGAGATCTATGACTGGCAT
GGCCGGCATCTGACGCCTGAAAGTGGCAGGCGCGGGGCCGCGCGCTGGATGGCGGCGATCGAAAGCGATG
TCGACCATGTCGAGGCGCTGGCGACCAATCGATGCCTGGCGCCGGGCGATATGTTCACGCTGACCGGCCA
CCCGTCTGAGGTCGAGAACGGCAGCCCCCATGTGGTGACGGCGGTGTCGCACCGCGCCAGCGCCGAGGGG
TATGAGGTCGGCACTGCCGGCGATGCGCCGCGCTATGCGGCGGAATTCCGCGCCATTCCGGCGGCGACCC
GCTATGTGACGCCCGAGACCACGCCGCGCCCGGCGATCGACGGCATCCAGACCGCAACCGTGGTCGGCCC
CAAGGGCGAGGAGATCCACACCGACCGCTATGGCCGGATCAAGGTCCGCTTTCCCTGGGATCGCTATGCC
ACCGGCGACGACCGGTCGTCGTGCTGGATCCGGGTGATGCAGCCCTGGGGCGGGCGGGGCATGGGCGTGC
AGACCATTCCGCGCATCGGCATGGAGGTGATGGTCGCCTTCATCGAGGGCGACCCCGACCGGCCGCTGGT
GGTCGGCACCGTGCCCAATGCCGAGACCATGCCGCCCCTGACCCTGCCTGCGACCAAGACCCGGACCTCG
TTCAAATCCACCACCAGCCCCGGCGGCGGTGGCTTCAACGAGCTGAGCTTCGAGGATCTGGCCGGGGCGG
AGGAGCTTTTGTTCCGCGCCCAGCGCGACCATGCCCGCATGGCCGGCCGCAACCGCATGATCAACACCGC
CAATGTCTCGACCGAGGACACCAACACGCTCTGGGGCAGTGCGGTCGGCAACAGCGAGGTGGTGAAGACC
CGCGCCAATGTGCTGATCCAGCATGTGATGAGCCGGATCATCCTGGATGGCGAGCGGGTGCGGTTCGAAC
ATACCAACGGCCATTTCTTCGACCTGTCGGCCGAAGGCATCAGCTTTTCGTCGACCAACAAGCTGCTTCA
GCTGCGCAACACCGACAATTTCATCTTCGTCAACAAAGACGGGGTGGTGCGCAAGGGCAAGGTGCTGCTG
GATGAGGATGCCGGCGGCACATCCTCGGTGACGATTTCCGCCGACGGCGTCGGCAGCAACGGCCCGCTGG
TGATGCTGAATTGCGGGCCGGCCTATGGCGACTATGTTCAGAACCAGCCCGCCACCCCCGGAACCGAGGG
CGACCGCGAGGCCTGGAAGGCCGAAGGCGACGCCTGGGCCGGCACGCGCGACGGCGATGGCGGCACGGCC
CGGGTGATGGGCGGCGAAGGATCGATCACCGCCGATGACGGCCGGGTGGAGGCCGAGTTCAAGGGCGGCG
GGGCCTTCCTGGATGGCGATCTGGAAGGCGAATACGGCAGCGTCGGCGGCAAGCTGAACGTGCTCGGTGC
CGAGGGCAAGGGCCATGCCGGCGTCGGCTATGGTGCCGGCGCCTATGGCGAGGCCCGGGCCAGCATGGTG
GATGCCAATGTCCGCGGTGCGCTGGGCGATCTGGAGACCGGCGGTGTCGGCGGCCAGGCGGAATACCGCC
AGATGGCGGCCTCGGCCAAGGGCGAGATCCTGCTGGGCGATGACGGCCGCCGTGCGGGTCTGGCGCTGGG
CGGCATGGCCAGCGCCTCGGCGCTGGAAGGCGGGTTGCAGGGCGATGTCACCATCCCGATCGGCTGGCTG
CCCTGGGTGCCCGACGACTATACGATCAATCTTCAGGGTCGCCTGACCGGTGCCGCCGGCACCGTTGCCG
CCTCGGCGGGCGGGTTCGGCTATTACGACTATGGCGGCGACGGTCGCGTCCATGGCGGCGCCTATGCCAA
GCTGGGCGCGATCCTGGGGGCGGGCGTGCGGCTGAAGGGCAGCATCGGCCCCTCGGGCGGTGGAGACTAG