SecReT6
Protein ID: 389875330
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0078
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]81725..83263 [-]
Producthypothetical protein
NoteTssL
UniProt IDI3TRU3
KEGG IDtmo:TMO_a0078
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-69, Aligned region: 111..316
OmpA [PF00691], Evalue: 1.50E-14, Aligned region: 390..488
Protein Sequence: 512 a.a.     [Download]
>gi|389875330|ref|YP_006373065.1| hypothetical protein TMO_a0078 [Tistrella mobilis KA081020-065]
MVDDDPFGEDADRTILRPRPGRARAAAVVTDPAERTVVPALGRLAEARAHGGYADHDAPGHDALGHGPFR
PGPVEPGVGPLDDDGGPWPQDGGVAEAVPEASGIFARTGVNPLARAAAPLFALIVRLKGRAVHRDVPTLR
QRVIAEIRAFERRAAADGVDGETLRAARYAVAATVDDVVLNTPWGGRSIWTGQSMVSTFYNETWGGERFF
DILDRSLEQPARHVTLLELMYLCLSLGFEGRYRVDPAGAQTLGLVRDRVWRAIRQVRDEPAAALSPHWQG
LEAAHRPLGTLVPLWLVGVGTLVLLVLVFAGFRLALDARTQPVLAAVETLPPTDAVVIARSAPTPPPLVV
TENQAGERLRRFLEPEIREGLVTVLEDAQSVTVRLNSNGLFASASDTVLDAQRPTLDRIGQALEAEPGRV
QVVGHTDSQPISTIRFPNNTALSVARAEAVVELLKRHVSDPGRFTVEGRAAAEPIADNATAAGRAQNRRI
EIILMKTAETGSAAATTSGRAS
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c83263-81725 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGGTCGATGACGATCCCTTCGGCGAAGATGCCGACCGCACGATTCTGAGACCGCGCCCGGGGCGCGCCC
GCGCCGCCGCGGTGGTGACCGACCCGGCCGAACGCACGGTGGTGCCGGCGCTGGGCCGGCTGGCCGAGGC
CCGCGCCCATGGCGGCTATGCCGATCATGATGCCCCGGGTCACGATGCCCTGGGGCATGGGCCGTTCCGG
CCGGGGCCGGTCGAGCCCGGGGTCGGGCCGCTGGACGACGACGGCGGACCCTGGCCGCAGGATGGCGGTG
TGGCCGAAGCGGTGCCGGAAGCCTCCGGCATCTTCGCCCGCACCGGCGTCAACCCGTTGGCCCGGGCCGC
CGCCCCCCTGTTCGCGCTGATCGTGCGGCTGAAGGGGCGCGCGGTGCATCGCGACGTGCCGACCCTGCGC
CAGCGGGTGATCGCCGAAATCCGCGCCTTCGAACGCCGCGCCGCGGCCGACGGCGTGGATGGCGAGACGC
TGCGCGCCGCGCGCTATGCCGTGGCCGCGACGGTCGACGACGTGGTGCTGAACACCCCCTGGGGCGGCCG
GTCGATCTGGACCGGCCAGTCGATGGTGTCGACCTTCTACAACGAGACCTGGGGCGGCGAACGCTTCTTC
GACATCCTGGACCGCAGCCTGGAACAGCCGGCCCGACATGTGACGCTGCTGGAGCTGATGTATCTGTGCC
TGTCGCTGGGCTTCGAGGGCCGCTATCGGGTCGATCCGGCCGGGGCGCAGACGCTGGGCCTGGTGCGCGA
CCGGGTGTGGCGGGCGATCCGCCAGGTGCGCGACGAACCCGCAGCCGCGCTGTCGCCGCACTGGCAGGGG
CTGGAAGCCGCCCATCGGCCGCTGGGCACGCTGGTGCCGCTGTGGCTTGTGGGGGTGGGCACGCTGGTGC
TGCTGGTGCTGGTCTTCGCCGGTTTCCGCCTGGCGCTGGATGCCCGCACCCAGCCGGTGCTGGCGGCGGT
GGAAACCCTGCCGCCGACCGATGCGGTGGTGATCGCGCGGTCGGCACCCACCCCGCCGCCGCTGGTGGTG
ACCGAAAACCAGGCGGGTGAGCGGCTGCGCCGCTTCCTGGAGCCCGAGATCCGCGAAGGGCTGGTGACGG
TGCTGGAAGATGCCCAGTCGGTGACCGTGCGGCTGAACAGCAACGGGCTGTTCGCCTCCGCCAGCGACAC
GGTGCTGGATGCCCAGCGCCCGACGCTGGACCGGATCGGCCAGGCGCTGGAGGCAGAGCCCGGCCGGGTG
CAGGTCGTGGGCCACACCGACAGCCAGCCGATTTCCACCATCCGCTTCCCCAACAATACCGCCCTGTCGG
TCGCCCGTGCCGAGGCGGTGGTCGAGCTGCTGAAGCGTCACGTCTCGGATCCCGGCCGGTTCACGGTCGA
GGGCCGGGCCGCCGCCGAGCCGATCGCCGACAACGCCACCGCCGCCGGCCGCGCCCAGAACCGCCGCATC
GAGATCATCCTGATGAAGACCGCCGAAACCGGCTCTGCCGCCGCCACCACCAGCGGGAGGGCATCCTGA