SecReT6
Protein ID: 389875331
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0079
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]83267..84610 [-]
Producthypothetical protein
NoteTssK
UniProt IDI3TRU4
KEGG IDtmo:TMO_a0079
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.40E-157, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|389875331|ref|YP_006373066.1| hypothetical protein TMO_a0079 [Tistrella mobilis KA081020-065]
MSWDNKVVWSEGMFIRPQHFQQQDRWIEKLVRGRVADLGPCPWGLVELAVDQDLLGTGRFAAARVRGVFE
DGTLFSVPDDTDHPAPLAVPPDTRNRLVYLGVPLRRPGAADVDHADAPEAGTRFAAREIEVADANAFSTA
EARIGIGRLRLRYLLEGEDRAGYATIALARIVEVRPDRQIVLDTRFVPPVLTVTASPVLTGHATEIAGML
HQRGEALADRVAHAGSGGVAEIADFMLLQTVNRHEPVFAHLLALSRLHPERLYTEMLALMGDLAVFTAGA
KRPASLPPYEHEDLGRTFRAVMTELRQALSAVLEQTAIPVPLELRNYGIRVARIDDRSLLDQAAFVLAVK
ADAPAEAVRRHLPQQMKIGPVEQIRNLVNAALPGIAIRPLAVAPRQLPFHPGVQYFELERTSRFWDDLKT
SGGMAVHVAGEFPGLVLECWAIKAPQV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c84610-83267 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
ATGTCATGGGACAACAAGGTCGTCTGGTCCGAGGGCATGTTCATCCGGCCCCAGCATTTCCAGCAGCAGG
ATCGCTGGATCGAAAAGCTGGTGCGCGGCCGGGTGGCAGATCTGGGCCCCTGCCCCTGGGGGCTGGTCGA
GCTTGCCGTCGATCAGGATCTTCTGGGGACAGGCCGCTTTGCCGCGGCACGGGTGCGGGGCGTGTTCGAG
GACGGCACCCTGTTCTCGGTACCCGACGACACCGACCATCCGGCCCCCCTGGCCGTGCCGCCCGACACCC
GTAACCGGCTTGTCTATCTGGGGGTTCCATTGCGCCGCCCCGGGGCGGCCGATGTCGATCATGCCGATGC
GCCCGAGGCCGGCACCCGGTTTGCCGCGCGCGAGATCGAGGTGGCCGATGCCAATGCCTTCAGCACGGCC
GAGGCCCGGATCGGCATCGGGCGGCTCAGGCTGCGCTATCTGCTGGAAGGCGAGGACCGCGCCGGCTATG
CCACGATCGCACTCGCCCGGATCGTCGAGGTCCGGCCCGACCGGCAGATCGTGCTGGATACCCGTTTCGT
GCCGCCGGTGCTGACGGTGACCGCATCGCCGGTGCTGACCGGCCATGCGACCGAGATCGCCGGCATGCTG
CATCAGCGCGGCGAGGCGCTGGCCGACCGCGTCGCCCATGCCGGATCGGGCGGGGTGGCCGAGATCGCCG
ACTTCATGCTGCTGCAGACCGTCAACCGCCACGAGCCGGTCTTTGCGCATCTGCTGGCGCTCAGCCGGCT
GCATCCGGAACGGCTGTACACGGAGATGCTGGCGCTGATGGGCGATCTGGCGGTGTTCACCGCCGGCGCC
AAGCGGCCGGCATCGCTGCCGCCCTATGAACACGAGGATCTTGGCCGCACCTTCCGGGCGGTGATGACGG
AACTGCGCCAGGCGCTGTCGGCGGTGCTGGAACAGACCGCCATCCCCGTGCCGCTGGAACTGCGCAATTA
CGGCATCCGCGTCGCCCGCATCGACGATCGCAGCCTGCTGGACCAGGCCGCCTTCGTGCTGGCGGTGAAG
GCCGATGCGCCGGCCGAAGCCGTGCGCCGCCATCTGCCGCAGCAGATGAAGATCGGCCCGGTGGAACAGA
TCCGCAATCTGGTGAACGCGGCCCTGCCCGGCATCGCCATCCGGCCGCTGGCCGTGGCGCCGCGTCAACT
GCCCTTCCATCCGGGGGTGCAGTATTTCGAACTCGAACGCACCAGCCGGTTCTGGGACGACCTGAAGACC
TCTGGCGGCATGGCGGTCCATGTCGCCGGCGAGTTCCCGGGTCTGGTTCTGGAATGCTGGGCGATCAAGG
CGCCGCAGGTGTGA