SecReT6
Protein ID: 389875332
SecReT6 ID665
T6SS typei5
Gene symbol-
Locus tagTMO_a0080
StrainTistrella mobilis KA081020-065
Repliconplasmid pTM1 [GenBank: NC_017957] [Browse all T6SS(s) in this replicon]
Location [Strand]84669..85178 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDI3TRU5
KEGG IDtmo:TMO_a0080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.20E-35, Aligned region: 34..155
Protein Sequence: 169 a.a.     [Download]
>gi|389875332|ref|YP_006373067.1| type VI secretion lipoprotein, VC_A0113 family [Tistrella mobilis KA081020-065]
MAIILSLPLQACSDRPVSDLIGTADRLFSLRFGDSAPDEAEIAIMAHEDANPDAEGRASPVVLRFFQLSQ
SGAFQQADYFALNENPRGVLGGTLIDQGELVMAPGSSRELVFSADQRTRAIGVVAGFRDIDEARWRSLIE
VDPYDLEPLQVVIDGTDVTIQLQPDDGGW
 
Nucleotide Sequence: 510 bp     [Download]
>gi|442559580|ref|NC_017957.2|:c85178-84669 Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence
TTGGCCATAATCCTGTCCCTGCCGCTCCAGGCCTGCAGCGACCGGCCGGTCAGCGACCTGATCGGCACCG
CCGACCGCCTGTTCAGCCTGCGCTTCGGCGACAGCGCGCCCGACGAGGCCGAGATCGCGATCATGGCCCA
TGAGGACGCCAACCCGGATGCGGAAGGCCGCGCCTCGCCGGTGGTGCTGCGCTTCTTCCAGCTGAGCCAG
TCCGGCGCCTTCCAGCAGGCGGATTATTTCGCGCTCAACGAAAACCCGCGGGGCGTGCTGGGCGGCACGC
TGATCGACCAGGGCGAACTGGTCATGGCCCCGGGCAGCAGCCGCGAGCTGGTGTTCTCGGCCGACCAGCG
CACCCGCGCGATCGGCGTGGTCGCCGGCTTCCGCGACATCGACGAGGCCCGGTGGCGCTCGCTGATCGAG
GTCGACCCCTACGACCTGGAACCGCTTCAGGTGGTGATCGACGGCACCGACGTCACGATCCAGCTTCAGC
CGGACGACGGTGGCTGGTGA